DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and AT2G33255

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_850204.2 Gene:AT2G33255 / 817888 AraportID:AT2G33255 Length:245 Species:Arabidopsis thaliana


Alignment Length:226 Identity:45/226 - (19%)
Similarity:83/226 - (36%) Gaps:71/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRL-------LPVAK 194
            |.|:|..:  .|..:|.|:.|:|..||.|.|..|.:|    ..:|.|.|..|:       :.:..
plant    21 SMANLTTN--AKTRLRGVVFDMDGTLTVPVIDFAAMY----RAVLGEDAYKRIKAESPSGIDILH 79

  Fly   195 EVNIVGPG----AFASIL-VEASGKQPITLGKPG----------------------RELGDLLVE 232
            .:....|.    |:..|. .|..|...:.: .||                      ::..|:..:
plant    80 HIESWSPDKQQKAYEIIADYEKQGIDKLQI-MPGTAELCGFLDSKKIKRGLITRNVQKAIDIFHQ 143

  Fly   233 HYQI----------------------------VQPSRVLMIGDMLAQDVSFGRQCGFQTLLVLSG 269
            .:::                            :||:.|:|:||.|..|::.|::.|..|.|:...
plant   144 RFEVIFSPALGREFRPYKPNPDPLLHICSTWDIQPNEVMMVGDSLKDDIACGKRAGAFTCLLDET 208

  Fly   270 GCSKEELLAETDPQRIPDYYADSVADVAQML 300
            |....:..:.:..|  ||:..||::.:..:|
plant   209 GRYGPDDFSVSGLQ--PDFKVDSLSKIQNLL 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 44/220 (20%)
Hydrolase_6 25..125 CDD:290083
Hydrolase_like 219..295 CDD:289983 21/125 (17%)
AT2G33255NP_850204.2 HAD-SF-IA-v1 35..199 CDD:273686 30/168 (18%)
HAD_like <181..237 CDD:419670 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.