DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and Pdxp

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001129291.1 Gene:Pdxp / 727679 RGDID:1586212 Length:292 Species:Rattus norvegicus


Alignment Length:288 Identity:91/288 - (31%)
Similarity:144/288 - (50%) Gaps:31/288 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKLFAKIGMQ-VHPEQIW 88
            |:.|.|||||..|:.:|.|.:....|.|.||...|::|||.|...:....||::|.. :..|:::
  Rat    22 VLFDCDGVLWNGERIVPGAPELLQRLAQAGKATLFVSNNSRRARPELALRFARLGFTGLRAEELF 86

  Fly    89 HPAKSIVSYLQS-----IKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGK 148
            ..|......|:.     ....|.::::..:..:..||.||.:|...|                |.
  Rat    87 SSAVCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDP----------------GD 135

  Fly   149 EP-VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDR--LLPVAKEVNIVGPGAFASILVE 210
            :| ||||::..|.:.:..|:..|..:||.|:|:|:  ||||  ..|:.......|.|:.|:.:..
  Rat   136 DPRVRAVLVGYDEHFSFAKLTEACAHLRDPDCLLV--ATDRDPWHPLTDGSRTPGTGSLAAAVET 198

  Fly   211 ASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTLLVLSGGCSKEE 275
            |||:|.:.:|||...:...:.|.:. |.|:|:||:||.|..|:.||.:||..|:|.|:|..|.||
  Rat   199 ASGRQALVVGKPSPYMFQCITEDFS-VDPARMLMVGDRLETDILFGHRCGMTTVLTLTGVSSLEE 262

  Fly   276 ---LLAETDPQRIPDYYADSVADVAQML 300
               .||......:|.||.:|:||:.:.|
  Rat   263 AQAYLAAGQHDLVPHYYVESIADLMEGL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 89/282 (32%)
Hydrolase_6 25..125 CDD:290083 30/105 (29%)
Hydrolase_like 219..295 CDD:289983 30/78 (38%)
PdxpNP_001129291.1 PGP_euk 18..286 CDD:273635 89/282 (32%)
Hydrolase_6 22..128 CDD:290083 30/105 (29%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q96GD0 58..60 0/1 (0%)
Hydrolase_like 206..286 CDD:289983 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343744
Domainoid 1 1.000 60 1.000 Domainoid score I10306
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.