DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and PDXP

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_064711.1 Gene:PDXP / 57026 HGNCID:30259 Length:296 Species:Homo sapiens


Alignment Length:288 Identity:92/288 - (31%)
Similarity:147/288 - (51%) Gaps:27/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKLFAKIGM-QVHPEQIW 88
            |:.|.|||||..|:::|.|.:....|.:.||...|::|||.|...:....||::|. .:..||::
Human    22 VLFDCDGVLWNGERAVPGAPELLERLARAGKAALFVSNNSRRARPELALRFARLGFGGLRAEQLF 86

  Fly    89 HPAKSIVSYLQS-----IKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGK 148
            ..|......|:.     ....|.::::..:..:..||.||.:|...|         |..:   |.
Human    87 SSALCAARLLRQRLPGPPDAPGAVFVLGGEGLRAELRAAGLRLAGDP---------SAGD---GA 139

  Fly   149 EP-VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDR--LLPVAKEVNIVGPGAFASILVE 210
            .| ||||::..|.:.:..|:..|..:||.|||:|:  ||||  ..|::......|.|:.|:.:..
Human   140 APRVRAVLVGYDEHFSFAKLREACAHLRDPECLLV--ATDRDPWHPLSDGSRTPGTGSLAAAVET 202

  Fly   211 ASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTLLVLSGGCSKEE 275
            |||:|.:.:|||...:.:.:.|::.| .|:|.||:||.|..|:.||.:||..|:|.|:|....||
Human   203 ASGRQALVVGKPSPYMFECITENFSI-DPARTLMVGDRLETDILFGHRCGMTTVLTLTGVSRLEE 266

  Fly   276 ---LLAETDPQRIPDYYADSVADVAQML 300
               .||......:|.||.:|:||:.:.|
Human   267 AQAYLAAGQHDLVPHYYVESIADLTEGL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 90/282 (32%)
Hydrolase_6 25..125 CDD:290083 30/105 (29%)
Hydrolase_like 219..295 CDD:289983 29/78 (37%)
PDXPNP_064711.1 PGP_euk 18..290 CDD:273635 90/282 (32%)
Substrate binding. /evidence=ECO:0000269|PubMed:18058037, ECO:0007744|PDB:2P27 58..60 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.