DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and zgc:77375

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_991194.1 Gene:zgc:77375 / 402927 ZFINID:ZDB-GENE-040426-1827 Length:429 Species:Danio rerio


Alignment Length:273 Identity:68/273 - (24%)
Similarity:107/273 - (39%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIDGVLWTFEQSIPRAADGYAAL-EQMGKHL---TFLTN--NSVRTSEQCVKLFAKIGMQVHPEQ 86
            ||||||...:..||.|...:..| :..|:.|   .|:||  |.:| .::..:|...:|:.:..:|
Zfish    37 DIDGVLVRGKTPIPAAKRAFQKLVDTKGQFLVPVVFVTNAGNCLR-QKKADQLSHILGVPISQDQ 100

  Fly    87 IW---HPAKSIVSYLQS---IKFEGLIYIIASQ-SFKTV-----LREAGFQLLDG---------P 130
            :.   .|.:....|...   :..:|.:..||.. .|..|     |||: |.|||.         |
Zfish   101 VMMSHSPLRMFKKYHDKFVLVSGQGPVLDIAKNVGFTNVVSIDMLRES-FPLLDMVDHNRRPKLP 164

  Fly   131 NEFIEESYASLAEHIFGKEPVR-----AVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLL 190
            :..:.......|..:|| ||:|     .:|:||  .||:..:..|:.........|:....|.:.
Zfish   165 SSPVANLPRVEAVVLFG-EPIRWETNLQLIVDV--LLTNGNLSSAYETAHSTHLPLLACNMDLMW 226

  Fly   191 PVAKEVNIVGPGAF----ASILVEASGKQ---PITLGKPGR---ELGDLLVEHYQIVQ----PSR 241
            .........|.|.|    .||..:.:||:   ...:|||..   ...:.|:....:.:    |.|
Zfish   227 MAEAHSPRFGHGTFMVCLESIYKKITGKELKYEALMGKPSELTYHFAEFLIREQAVERGWRAPIR 291

  Fly   242 VL-MIGDMLAQDV 253
            .| .|||.|..|:
Zfish   292 SLYAIGDNLMTDI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 68/273 (25%)
Hydrolase_6 25..125 CDD:290083 30/114 (26%)
Hydrolase_like 219..295 CDD:289983 12/43 (28%)
zgc:77375NP_991194.1 Hydrolase_6 34..137 CDD:290083 25/100 (25%)
HAD-SF-IIA 35..310 CDD:273637 68/273 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.