DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and CG11291

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_611656.2 Gene:CG11291 / 37541 FlyBaseID:FBgn0034713 Length:308 Species:Drosophila melanogaster


Alignment Length:307 Identity:81/307 - (26%)
Similarity:145/307 - (47%) Gaps:20/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HILQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQ 70
            |:.:|.:.:.:..:...|.::...|||||.....|..:.:.:.|:...||.....||....|::.
  Fly     8 HLDKLPKAKVAEWLAGIDTIICSTDGVLWQENTPIEGSVEAFNAIISKGKRCLIATNECCLTNKD 72

  Fly    71 CVKLFAK---IGMQVHPEQIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLDGPNE 132
               ||.|   :|..|..:.|:..:.:|.|||...||:..|.::.....:..|:||||..:....:
  Fly    73 ---LFQKAKCLGFNVKEQDIFSSSGAIASYLSDRKFKKKILVLGGDGIRKDLKEAGFCSVVNDLQ 134

  Fly   133 FIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVN 197
            ..::........:.....|.||::..|.|:.:.::|.|..||::|:.:.:....|...|..|: .
  Fly   135 PNDQKKIDFVRSLVLDPDVGAVLVARDDNMIANELLVACNYLQNPKVLFLTTCIDGFQPFGKK-R 198

  Fly   198 IVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQ 262
            |...|:.||.:.....::||.||||.:.:...|::..:| :|.:.|:||:.|..|:.|...||||
  Fly   199 IPDAGSLASAIEIIVQRKPIVLGKPNQRILGKLMKSGEI-KPEKTLVIGNSLKSDILFASICGFQ 262

  Fly   263 TLLVLSGGCSK------EELLAETDPQR---IPDYYADSVADVAQML 300
            :|||   ||..      |::..|.|.::   :||.:...:|...:.|
  Fly   263 SLLV---GCDNGAIEKAEKIKKEGDEKKMKLVPDAFLSGLASFGEYL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 78/284 (27%)
Hydrolase_6 25..125 CDD:290083 29/102 (28%)
Hydrolase_like 219..295 CDD:289983 27/84 (32%)
CG11291NP_611656.2 PGP_euk 24..300 CDD:273635 77/283 (27%)
Hydrolase_6 27..127 CDD:290083 29/102 (28%)
Hydrolase_like 219..284 CDD:289983 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I299
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19288
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.