DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and Lhpp

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_038939164.1 Gene:Lhpp / 361663 RGDID:1359187 Length:312 Species:Rattus norvegicus


Alignment Length:330 Identity:71/330 - (21%)
Similarity:119/330 - (36%) Gaps:91/330 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VVSDIDGVLWTF----EQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKLFAKIGMQVHPE 85
            |:.||.|||:..    ..:|..:.:..|.|::....:.|.||.|.::..:.|.:..::|..:...
  Rat    14 VLLDISGVLYDSGTGGGAAIAGSVEAVARLKRSPLKVRFCTNESQKSRRELVGVLQRLGFDISEG 78

  Fly    86 QIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGKEP 150
            ::..||.:...                     :|:|.|.:    |:..|.|...|..:.|....|
  Rat    79 EVTAPAPATCQ---------------------ILKERGLR----PHLLIHEGVRSEFDDIDMSNP 118

  Fly   151 VRAVIIDVDFNLTSPKILRAH---LYLRHP----------------------------------- 177
            ...||.|.....:...:.||.   :.|.:|                                   
  Rat   119 NCVVIADAGEGFSYQNMNRAFQVLMELENPVLISLGKGLIVARGYSRLQVEAWINGSVGQDGEKS 183

  Fly   178 ECMLIEGATDRLLP-----VAKEVN--IVGPGAFASILVEASGKQPITLGKPGRE-----LGDLL 230
            :|.|:   ..|.||     ..||.:  ::..|.:...|..|.|.:...:|||..|     |..:.
  Rat   184 DCSLL---AVRELPHTEPRYYKETSGLMLDVGGYMKALEYACGIEAEVVGKPSPEFFRSALQAIG 245

  Fly   231 VEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTLLVLSGGCSKEELLAETDPQRIPDYYADSVAD 295
            ||.:|      .:||||.:..||...:|||.:.|.|.:|.....:   |..|:...|.|.|::|:
  Rat   246 VEAHQ------AIMIGDDIVGDVGGAQQCGMRALQVRTGKFRPGD---EHHPEVRADGYVDNLAE 301

  Fly   296 VAQML 300
            ...:|
  Rat   302 AVDLL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 70/324 (22%)
Hydrolase_6 25..125 CDD:290083 20/103 (19%)
Hydrolase_like 219..295 CDD:289983 25/80 (31%)
LhppXP_038939164.1 HAD-SF-IIA-hyp3 11..309 CDD:162372 71/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343741
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D982374at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.710

Return to query results.
Submit another query.