DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and CG17294

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_609219.1 Gene:CG17294 / 34155 FlyBaseID:FBgn0032032 Length:255 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:105/294 - (35%) Gaps:74/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKLFAKIGMQVHPEQIWHPAK 92
            |:.|.|...::..|.|.:....|...|..:.|:||.:..:.....:...:||.|:...:|:....
  Fly     9 DLSGTLHVEDEPTPNAVEALKRLRDSGVLVKFVTNTTKDSKATLHERLCRIGFQLDASEIYSSLS 73

  Fly    93 SIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLDGPNE----FIEESYASLAEHIFGKEPVRA 153
            :.|||:::.:...  |.|.|:..:.          |.|.|    :.:.....||...|..|.:..
  Fly    74 AAVSYVENERLNP--YYILSEDARQ----------DFPPEDTRRYKDSVVIGLAPKAFNYEQLNE 126

  Fly   154 VIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAK-------EVNIVGPGAFASILVEA 211
            .     ||                  :|:|....:|:.|.:       |...:|||.|...|..|
  Fly   127 A-----FN------------------VLLENKNHKLIAVHQGKYYKRAEGLALGPGCFVKGLEFA 168

  Fly   212 SGKQPITLGKP----------GRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTLLV 266
            :|:....:|||          ||:             |:..:||||....|:......|.|.:||
  Fly   169 TGRTAKVIGKPNPYFFEGALAGRD-------------PASCVMIGDDANDDIVGAMSMGMQGILV 220

  Fly   267 LSGGCSKEELLAETDPQRIPDYYADSVADVAQML 300
            .:|     :.|.:..|...|....::.|:....:
  Fly   221 KTG-----KYLPDVKPSPPPTALLENFAEAVDWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 61/288 (21%)
Hydrolase_6 25..125 CDD:290083 20/96 (21%)
Hydrolase_like 219..295 CDD:289983 19/85 (22%)
CG17294NP_609219.1 HAD-SF-IIA-hyp3 3..251 CDD:162372 61/294 (21%)
Hydrolase_6 7..98 CDD:290083 20/100 (20%)
DUF843 <84..136 CDD:114536 14/86 (16%)
Hydrolase_like 175..245 CDD:289983 20/87 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453838
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.