DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and Hdhd5

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_006237308.2 Gene:Hdhd5 / 312680 RGDID:1306557 Length:423 Species:Rattus norvegicus


Alignment Length:369 Identity:77/369 - (20%)
Similarity:130/369 - (35%) Gaps:130/369 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLSQE------QRSSVVDSFDR-----VVSDIDGVLWTFEQSIPRAADGYAAL----EQMGKHL 57
            ::||.|      :|..|.|..:|     ::.||||||....:.||.|.:.::.|    .|:...:
  Rat    21 VRLSAEFQGYGPRRGYVADRAERSPTFGLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLQVPV 85

  Fly    58 TFLTN-NSVRTSEQCVKLFAKIGMQVHPEQIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLRE 121
            .|:|| .::...::..:|.|.:..:|.|:|:                     |::....|..|:.
  Rat    86 VFVTNAGNILQRDKAQELSALLECKVDPDQV---------------------ILSHSPMKLFLQY 129

  Fly   122 AGFQLL-DGPNEFIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGA 185
            ...::| .|....:|.:.|...:::        |.:| |..:..|::....|. |.|:.|:|...
  Rat   130 HNKRMLVSGQGPLVENARALGFQNV--------VTVD-DLRIAFPELDMVDLQ-RRPKTMVIRTR 184

  Fly   186 TDRLLPVAKEVNIVG---------------------PGA------------FAS---ILVEASGK 214
            .....|..:.|.::|                     |||            .||   :|..|...
  Rat   185 PRSDFPAIEGVLLLGEPVRWETNLQLITDVLLSNGHPGAGLATAPYPHLPVLASNMDLLWMAEAS 249

  Fly   215 QP-----------------IT---------LGKPGRELGDLLVEHY--QIVQ----------PSR 241
            .|                 ||         :|||     .:|...|  ::::          |.|
  Rat   250 MPRFGHGTFLLCLETIYRKITGHELKYEGLMGKP-----SILTYRYAEEVIRQQAERRGWAAPIR 309

  Fly   242 VL-MIGDMLAQDVSFGRQCGFQTLLVLSGGCSKEELLAETDPQR 284
            .| .|||....|| :|.....|.|.:.:|| .||:.....:.||
  Rat   310 KLYAIGDNPMSDV-YGANLFHQYLQMANGG-EKEQRADGQEKQR 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 71/348 (20%)
Hydrolase_6 25..125 CDD:290083 22/104 (21%)
Hydrolase_like 219..295 CDD:289983 22/79 (28%)
Hdhd5XP_006237308.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.