DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and nipsnap2

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_571109.1 Gene:nipsnap2 / 30232 ZFINID:ZDB-GENE-991008-18 Length:286 Species:Danio rerio


Alignment Length:162 Identity:33/162 - (20%)
Similarity:49/162 - (30%) Gaps:51/162 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GMQVHPEQIW-----HPA-KSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLLDGPNEFIEES 137
            |.|.....:|     :|| ..::|.|::           ::.|.....|.|..||...|:.    
Zfish   119 GEQDQAVHLWRYRGGYPALTEVMSKLKN-----------NKEFLEYRSERGKMLLSRRNQL---- 168

  Fly   138 YASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVNIVGPG 202
               |.|..|..|||..         ..|.|.....|...|..|:..|.........::.|....|
Zfish   169 ---LLEFSFWNEPVPR---------DGPNIYELRSYQLRPGTMIEWGNYWARAIGYRQHNREAVG 221

  Fly   203 AFASILVEASGKQPITLGKPGRELGDLLVEHY 234
            .|.|                  ::|||.:.|:
Zfish   222 GFFS------------------QIGDLYMVHH 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 33/162 (20%)
Hydrolase_6 25..125 CDD:290083 10/51 (20%)
Hydrolase_like 219..295 CDD:289983 4/16 (25%)
nipsnap2NP_571109.1 NIPSNAP 187..284 CDD:285252 12/67 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.