DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and PGP

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001035830.1 Gene:PGP / 283871 HGNCID:8909 Length:321 Species:Homo sapiens


Alignment Length:318 Identity:90/318 - (28%)
Similarity:151/318 - (47%) Gaps:37/318 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCV 72
            ::||.|:..:::...|.::.|.|||||..|.::|.|.:...||...||.|.|:||||.:|.....
Human    14 VRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYA 78

  Fly    73 KLFAKIGM--QVHPE---QIWHPAKSIVSYLQSIKFEGL----IYIIASQSFKTVLREAGFQLL- 127
            :...::|.  ...|.   :::..|.....||:. :..|.    .|::.|.:....|...|...: 
Human    79 EKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQ-RLAGAPAPKAYVLGSPALAAELEAVGVASVG 142

  Fly   128 --------DGPNEFIEESYASLAEHIFGKEP-VRAVIIDVDFNLTSPKILRAHLYLRHPECMLIE 183
                    :||.:::   :|.|       || ||||::..|.:.:..|:.:|..||:.|.|:|:.
Human   143 VGPEPLQGEGPGDWL---HAPL-------EPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVG 197

  Fly   184 GATDRLLPVAKEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDM 248
            ...|..||:.....|.|.|.....:..|:.:|...:|||.|.:.|.:.:.|.| .|.|.:|:||.
Human   198 TNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGI-NPERTVMVGDR 261

  Fly   249 LAQDVSFGRQCGFQTLLVLSGGC------SKEELLAETDPQRIPDYYADSVADVAQML 300
            |..|:..|..||.:|:|.|:|..      :.:|....:..:.:||:|.||:||:...|
Human   262 LDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPAL 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 85/297 (29%)
Hydrolase_6 25..125 CDD:290083 30/108 (28%)
Hydrolase_like 219..295 CDD:289983 27/81 (33%)
PGPNP_001035830.1 PGP_euk 28..315 CDD:273635 85/298 (29%)
Hydrolase_6 31..138 CDD:290083 29/107 (27%)
Hydrolase_like 232..315 CDD:289983 28/83 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.