DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and NIPSNAP2

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001474.1 Gene:NIPSNAP2 / 2631 HGNCID:4179 Length:286 Species:Homo sapiens


Alignment Length:135 Identity:24/135 - (17%)
Similarity:43/135 - (31%) Gaps:41/135 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QCVKLFAKIGMQVHPE---------------QIWHPAKSIVSYLQSIKFEG--------LIYIIA 111
            :|::.:.||..:|.|:               ..|:..:....:|.  ::||        :..:..
Human    84 ECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLW--RYEGGYPALTEVMNKLRE 146

  Fly   112 SQSFKTVLREAGFQLLDGPNEFIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRH 176
            ::.|....:.....||...|:.       |.|..|..|||..         :.|.|.....|...
Human   147 NKEFLEFRKARSDMLLSRKNQL-------LLEFSFWNEPVPR---------SGPNIYELRSYQLR 195

  Fly   177 PECML 181
            |..|:
Human   196 PGTMI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 24/135 (18%)
Hydrolase_6 25..125 CDD:290083 10/77 (13%)
Hydrolase_like 219..295 CDD:289983
NIPSNAP2NP_001474.1 NIPSNAP 187..284 CDD:311781 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.