DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and Hdhd5

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_659064.1 Gene:Hdhd5 / 214932 MGIID:2136976 Length:419 Species:Mus musculus


Alignment Length:255 Identity:53/255 - (20%)
Similarity:97/255 - (38%) Gaps:60/255 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLSQEQRSSVVDSFDR-----VVSDIDGVLWTFEQSIPRAADGYAAL----EQMGKHLTFLTN- 62
            ||....:|..:..|.:|     ::.||||||....:.||.|.:.::.|    .|:...:.|:|| 
Mouse    27 LQGCGPRRGYIAGSAERSPTFGLLFDIDGVLVRGHRVIPAALEAFSKLVNSQGQLRVPVVFVTNA 91

  Fly    63 NSVRTSEQCVKLFAKIGMQVHPEQIWHPAKSIVSYLQSIKFEGLIYIIASQSFKTVLREAGFQLL 127
            .::....:..:|...:..:|.|:|:                     |::....|..|:....|:|
Mouse    92 GNILQHNKAQELSDLLRCKVDPDQV---------------------ILSHSPMKLFLQYHSKQML 135

  Fly   128 -DGPNEFIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECM-------LIEG 184
             .|....:|.:.|...:::        |.|| :..|..|::....|. |.|:.|       .|||
Mouse   136 VSGQGPLVENARALGFQNV--------VTID-ELRLAFPELDMVDLQ-RRPKTMRLRSDFPAIEG 190

  Fly   185 ATDRLLPVAKEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLM 244
            ......||..|.|:       .::::..    ::.|.||..|......|..::..:..|:
Mouse   191 VLLLGEPVRWETNL-------QLIMDVL----LSNGHPGTGLATAPYPHLPVLASNMDLL 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 49/240 (20%)
Hydrolase_6 25..125 CDD:290083 21/104 (20%)
Hydrolase_like 219..295 CDD:289983 6/26 (23%)
Hdhd5NP_659064.1 CECR5 47..358 CDD:200106 48/235 (20%)
Hydrolase_6 49..152 CDD:290083 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.