DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and Nipsnap1

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_006514638.1 Gene:Nipsnap1 / 18082 MGIID:1278344 Length:287 Species:Mus musculus


Alignment Length:59 Identity:14/59 - (23%)
Similarity:24/59 - (40%) Gaps:2/59 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLSQEQRSSVVDSFDRVVSDIDGV--LWTFEQSIPRAADGYAALEQMGKHLTFLTNNS 64
            |.|.::...|:|.:::....:.|..  ||.|....|...|....|:...::|.|....|
Mouse   101 LHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMNKLKNNKEYLEFRKERS 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 10/44 (23%)
Hydrolase_6 25..125 CDD:290083 10/42 (24%)
Hydrolase_like 219..295 CDD:289983
Nipsnap1XP_006514638.1 NIPSNAP 188..285 CDD:311781
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.