DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and pgph-1

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_504509.1 Gene:pgph-1 / 178963 WormBaseID:WBGene00019604 Length:322 Species:Caenorhabditis elegans


Alignment Length:303 Identity:90/303 - (29%)
Similarity:143/303 - (47%) Gaps:20/303 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVKLFAKIG- 79
            :.|:.:.|..:.|.|||||..|..:|.:......|.:..|.:..||||:.::.....|..||:| 
 Worm    23 AKVMKTIDTFIFDADGVLWLGESVMPGSPRLIDYLVKHNKQIIVLTNNATKSRAVYAKKLAKLGY 87

  Fly    80 --MQVHPEQIWHPAKSIVSYLQSIKFEG-LIYIIASQSFKTVLREAGFQLL-DGPNEFIEESYAS 140
              .:::...:.:||..:...|.....:| .:|:|..|..:..:.|.|.:.. .||.:..:|:..|
 Worm    88 NSSKMNKNNLVNPAAVVADTLHRAGLDGKRVYLIGEQGLRDEMDELGIEYFGHGPEKKQDEADGS 152

  Fly   141 LA--EHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAK-EVNIVGPG 202
            .|  ..|..:|.|.||::..:.:....|:::|..|||....:.:....|...|... ||.|...|
 Worm   153 GAFMYDIKLEENVGAVVVGYEKHFDYVKMMKASNYLREEGVLFVATNEDETCPGPNPEVVIPDAG 217

  Fly   203 AFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTLLVL 267
            ...:.:..|||:.|:|:|||.....:.:...:.| .|||.:||||....||.|||..|.:|||||
 Worm   218 PIVAAIKCASGRDPLTVGKPCTPAFNYIKRKWNI-NPSRTMMIGDRTNTDVKFGRDHGMKTLLVL 281

  Fly   268 SGGCSKEELLAETDPQR---IPDYYADSVADVAQMLGE-APKS 306
            ||....|:::.....:|   :|||       ||..||. .|:|
 Worm   282 SGCHQIEDIIENQMNERDDMVPDY-------VAPCLGALVPES 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 83/283 (29%)
Hydrolase_6 25..125 CDD:290083 27/103 (26%)
Hydrolase_like 219..295 CDD:289983 29/78 (37%)
pgph-1NP_504509.1 PGP_euk 28..313 CDD:273635 87/292 (30%)
Hydrolase_6 32..136 CDD:290083 27/103 (26%)
Hydrolase_like 234..313 CDD:289983 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161256
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0647
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.