DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and K02D10.1

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_498939.3 Gene:K02D10.1 / 176232 WormBaseID:WBGene00019301 Length:526 Species:Caenorhabditis elegans


Alignment Length:293 Identity:82/293 - (27%)
Similarity:138/293 - (47%) Gaps:29/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LQLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGY-AALEQMGKHLTFLTNNSVRTSEQC 71
            :.:::..::.::.::|..:.|.||||||.:..:|.|.:.. ..||...|.:..|||||.:|.||.
 Worm     1 MSINRISKNELLANYDTFLFDADGVLWTGDIPVPGAIEWINLLLEDPSKKVFVLTNNSTKTLEQY 65

  Fly    72 VKLFAKIGM-QVHPEQIWHPAKSIVSYLQS--IKFEG-LIYIIASQSFKTVL-REAGFQLL-DGP 130
            :|...|:|. .:....:..||..:..||:|  .||.| .:|:|.:::.|..| .:.|.:.. .||
 Worm    66 MKKIEKLGFGHLGRNNVISPAIVLADYLKSNADKFSGEYVYLIGTENLKATLENDGGVKCFGTGP 130

  Fly   131 N--------EFIEESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATD 187
            :        :||.:...|:|.        :||:...|.:.:.|||::|..||:.|....:....|
 Worm   131 DSIRDHTDGDFIHKVDMSIAP--------KAVVCSYDAHFSYPKIMKASNYLQDPSVEYLVTNQD 187

  Fly   188 RLLP-VAKEVNIVGPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQ 251
            ...| ....|.|.|.||.::.:...:|:.|...|||.:.:.|.|:.... |.|.|.:|.||.|..
 Worm   188 YTFPGPVPGVVIPGSGATSAAVTAVTGRDPKVFGKPHKPMADFLLRRAH-VDPKRTVMFGDRLDT 251

  Fly   252 DVSFGRQCGFQTLLVLSGGCSKEELLAETDPQR 284
            |:.||...|..:...:.  |..|.  ..::||:
 Worm   252 DIMFGNANGQLSATPIQ--CQNES--ENSEPQK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 82/278 (29%)
Hydrolase_6 25..125 CDD:290083 36/105 (34%)
Hydrolase_like 219..295 CDD:289983 20/66 (30%)
K02D10.1NP_498939.3 HAD-SF-IIA 18..264 CDD:273637 77/254 (30%)
Hydrolase_6 18..121 CDD:290083 35/102 (34%)
Hydrolase_like 219..>260 CDD:289983 15/41 (37%)
NIPSNAP 427..524 CDD:285252
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.