DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15739 and pgp

DIOPT Version :9

Sequence 1:NP_001259467.1 Gene:CG15739 / 32146 FlyBaseID:FBgn0030347 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001363850.1 Gene:pgp / 100488448 XenbaseID:XB-GENE-999283 Length:306 Species:Xenopus tropicalis


Alignment Length:301 Identity:94/301 - (31%)
Similarity:153/301 - (50%) Gaps:12/301 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 QLSQEQRSSVVDSFDRVVSDIDGVLWTFEQSIPRAADGYAALEQMGKHLTFLTNNSVRTSEQCVK 73
            :|:.|.....:.|.|.|:.|.|||||..:::||.|.|....|::..|.:.||||||.:|.....:
 Frog     8 RLNGELSRRFLASVDTVLFDCDGVLWRGDEAIPGAPDLINGLKRANKRVFFLTNNSTKTRSMYAE 72

  Fly    74 LFAKIGMQVHPEQIWHPAKSIVSYLQSI-KFEGLIYIIASQSFKTVLREAGFQLLDGPNEFI--- 134
            ...::|.:..||:::..|.....||:.| :.:|.:|:|..::.......||...|....:.:   
 Frog    73 KLGRLGFKAEPEEVFGTAYCTAIYLRDIARLKGKVYLIGGRALSEEFGAAGIPHLGCGADHVTGT 137

  Fly   135 EESYASLAEHIFGKEPVRAVIIDVDFNLTSPKILRAHLYLRHPECMLIEGATDRLLPVAKEVNIV 199
            ::.:||    :.|...|:||::..|.:.:..|:.||..||:.|.|:.|...||..||:.....|.
 Frog   138 QKDWAS----VQGDSDVKAVVVGFDEHFSYMKLNRALQYLQDPSCLFIATNTDTRLPLEGGRAIP 198

  Fly   200 GPGAFASILVEASGKQPITLGKPGRELGDLLVEHYQIVQPSRVLMIGDMLAQDVSFGRQCGFQTL 264
            |.|.....:..|:.::...:|||...|.|.:|:...: .|:|.:|:||.|..|:..|..||.:||
 Frog   199 GTGCLVRAVETAAHRKAQVIGKPSSFLYDCVVKDCGL-DPARTVMVGDRLDTDIQMGSTCGIRTL 262

  Fly   265 LVLSGGCSKEELLAETDP---QRIPDYYADSVADVAQMLGE 302
            |.|:|..|.|:..:..|.   ..:||||.:||||:...|.|
 Frog   263 LTLTGFSSLEDAKSYQDSGALSMVPDYYVNSVADLLPALSE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15739NP_001259467.1 PGP_euk 23..296 CDD:273635 88/279 (32%)
Hydrolase_6 25..125 CDD:290083 32/100 (32%)
Hydrolase_like 219..295 CDD:289983 30/78 (38%)
pgpNP_001363850.1 HAD_like 21..301 CDD:389748 89/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D337140at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19288
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R944
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.