DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS5 and Borcs5

DIOPT Version :9

Sequence 1:NP_572759.1 Gene:BORCS5 / 32145 FlyBaseID:FBgn0030346 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001163950.1 Gene:Borcs5 / 67774 MGIID:1915024 Length:196 Species:Mus musculus


Alignment Length:169 Identity:63/169 - (37%)
Similarity:99/169 - (58%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 VKPKRPQSTASSHNIVIVRPGAIDAGEDV--DMDLARLRNIPQFLPVLRESITSATNTRDAEILE 218
            |.|...:..|...:||:|..|: .|..:|  |.|:.:|:.||.|.|:|:..::..|:..:|: ||
Mouse    21 VTPSPAKHRAKMDDIVVVAQGS-QASRNVSNDPDVIKLQEIPTFQPLLKGLLSGQTSPTNAK-LE 83

  Fly   219 RLNSQHLINICTRMQTHLNLCASYVASEQNHLVERTKVVSNSITTLFAGFVDMQKTYASYAEQFA 283
            :|:||.::.:|.|.|.||:.||..||.:||.||:|.|.:..|:.|||....:.||.||.||||..
Mouse    84 KLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVETLFCFMQERQKRYAKYAEQIQ 148

  Fly   284 KIRSISHQLSRCNSLLHENIASLEAINNFLDDEDRLEPF 322
            |:..:|..|.|....:.:.:..:|.:|:.|.:.:|||||
Mouse   149 KVNEMSAILRRIQMGIDQTVPLMERLNSMLPEAERLEPF 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS5NP_572759.1 LOH1CR12 196..327 CDD:287167 49/127 (39%)
Borcs5NP_001163950.1 LOH1CR12 62..192 CDD:287167 49/127 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842761
Domainoid 1 1.000 94 1.000 Domainoid score I7488
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12188
Inparanoid 1 1.050 118 1.000 Inparanoid score I4789
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007451
OrthoInspector 1 1.000 - - oto94940
orthoMCL 1 0.900 - - OOG6_107243
Panther 1 1.100 - - LDO PTHR31634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3444
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.