DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS5 and borcs5

DIOPT Version :9

Sequence 1:NP_572759.1 Gene:BORCS5 / 32145 FlyBaseID:FBgn0030346 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001007053.1 Gene:borcs5 / 449650 ZFINID:ZDB-GENE-041010-83 Length:207 Species:Danio rerio


Alignment Length:168 Identity:55/168 - (32%)
Similarity:91/168 - (54%) Gaps:4/168 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 SGLTSAVKPKRPQSTASSHNIVIVRPGAIDAGEDV--DMDLARLRNIPQFLPVLRESITSATNTR 212
            |..:::|.|...:..|...:||:|..|. .:..::  |.|:.:|:.||.|.|:|: .:.|...:.
Zfish    14 SDFSASVVPSPAKHRAKMDDIVVVAQGT-QSLRNIHNDPDVIKLQEIPTFQPLLK-GVLSGQTSP 76

  Fly   213 DAEILERLNSQHLINICTRMQTHLNLCASYVASEQNHLVERTKVVSNSITTLFAGFVDMQKTYAS 277
            ....||:|:|..::.:|.|.|.||:.||..||.:||.||:|.|.:..|:..||:...:.||.||.
Zfish    77 STVCLEKLDSAQVLQLCVRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVEALFSIMQERQKRYAK 141

  Fly   278 YAEQFAKIRSISHQLSRCNSLLHENIASLEAINNFLDD 315
            ||||..|:..:|..|.|....:.:.:..:|.:||.|.:
Zfish   142 YAEQIQKVNEMSMILRRIQMGIDQTVPLMERLNNMLPE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS5NP_572759.1 LOH1CR12 196..327 CDD:287167 42/120 (35%)
borcs5NP_001007053.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 3/9 (33%)
LOH1CR12 61..179 CDD:287167 42/118 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587198
Domainoid 1 1.000 78 1.000 Domainoid score I8740
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12188
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446665at2759
OrthoFinder 1 1.000 - - FOG0007451
OrthoInspector 1 1.000 - - oto40142
orthoMCL 1 0.900 - - OOG6_107243
Panther 1 1.100 - - LDO PTHR31634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3444
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.