DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS5 and BORCS5

DIOPT Version :9

Sequence 1:NP_572759.1 Gene:BORCS5 / 32145 FlyBaseID:FBgn0030346 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_477517.1 Gene:BORCS5 / 118426 HGNCID:17950 Length:196 Species:Homo sapiens


Alignment Length:195 Identity:71/195 - (36%)
Similarity:114/195 - (58%) Gaps:9/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 QQSSASRAAARKSHPSGLTSAVKPKRPQSTASSHNIVIVRPGAIDAGEDV--DMDLARLRNIPQF 197
            :|||.:     :|.|:.|.|:|.|...:..|...:||:|..|: .|..:|  |.|:.:|:.||.|
Human     4 EQSSEA-----ESRPNDLNSSVTPSPAKHRAKMDDIVVVAQGS-QASRNVSNDPDVIKLQEIPTF 62

  Fly   198 LPVLRESITSATNTRDAEILERLNSQHLINICTRMQTHLNLCASYVASEQNHLVERTKVVSNSIT 262
            .|:|:..::..|:..:|: ||:|:||.::.:|.|.|.||:.||..||.:||.||:|.|.:..|:.
Human    63 QPLLKGLLSGQTSPTNAK-LEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKEMDLSVE 126

  Fly   263 TLFAGFVDMQKTYASYAEQFAKIRSISHQLSRCNSLLHENIASLEAINNFLDDEDRLEPFVWRTD 327
            |||:...:.||.||.||||..|:..:|..|.|....:.:.:..|:.:|:.|.:.:|||||..:.|
Human   127 TLFSFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLLDRLNSMLPEGERLEPFSMKPD 191

  Fly   328  327
            Human   192  191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS5NP_572759.1 LOH1CR12 196..327 CDD:287167 49/130 (38%)
BORCS5NP_477517.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 9/27 (33%)
LOH1CR12 61..191 CDD:287167 49/129 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152706
Domainoid 1 1.000 95 1.000 Domainoid score I7434
eggNOG 1 0.900 - - E1_KOG4515
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12188
Inparanoid 1 1.050 119 1.000 Inparanoid score I4790
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446665at2759
OrthoFinder 1 1.000 - - FOG0007451
OrthoInspector 1 1.000 - - oto91360
orthoMCL 1 0.900 - - OOG6_107243
Panther 1 1.100 - - LDO PTHR31634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3444
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.