DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BORCS5 and borcs5

DIOPT Version :9

Sequence 1:NP_572759.1 Gene:BORCS5 / 32145 FlyBaseID:FBgn0030346 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001106433.1 Gene:borcs5 / 100127605 XenbaseID:XB-GENE-940511 Length:196 Species:Xenopus tropicalis


Alignment Length:180 Identity:63/180 - (35%)
Similarity:99/180 - (55%) Gaps:8/180 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LTSAVKPKRPQSTASSHNIVIVRPGAID-AGEDVDMDLARLRNIPQFLPVLRESI---TSATNTR 212
            |:|:|.|...:..|...:||:|.||... .....|.::.:|:.||.|.|:|:..:   ||.||.|
 Frog    16 LSSSVSPSPAKQKAKMDDIVVVAPGTQSLRNVSKDPEVIKLQEIPTFQPLLKGLLSGQTSPTNVR 80

  Fly   213 DAEILERLNSQHLINICTRMQTHLNLCASYVASEQNHLVERTKVVSNSITTLFAGFVDMQKTYAS 277
                ||||:|..::.:|.|.|.||:.||..|:.:||.||:|.|.:.:|:..|::...:.||.:|.
 Frog    81 ----LERLDSPQVLQLCVRYQEHLHQCAEAVSFDQNALVKRIKEMDSSVDGLYSLMQERQKRFAK 141

  Fly   278 YAEQFAKIRSISHQLSRCNSLLHENIASLEAINNFLDDEDRLEPFVWRTD 327
            ||||..|:..:|..|.|....:.:.:..:|.:|..|.:.:|||||....|
 Frog   142 YAEQIQKVNEMSAILRRIQMGIDQTVPLMEKLNIMLPEGERLEPFCMSPD 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BORCS5NP_572759.1 LOH1CR12 196..327 CDD:287167 48/133 (36%)
borcs5NP_001106433.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 5/15 (33%)
LOH1CR12 61..191 CDD:287167 48/133 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 86 1.000 Domainoid score I8003
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12188
Inparanoid 1 1.050 105 1.000 Inparanoid score I4810
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1446665at2759
OrthoFinder 1 1.000 - - FOG0007451
OrthoInspector 1 1.000 - - oto105134
Panther 1 1.100 - - LDO PTHR31634
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3444
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.