DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and Fkbp6

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_030110810.1 Gene:Fkbp6 / 94244 MGIID:2137612 Length:363 Species:Mus musculus


Alignment Length:337 Identity:73/337 - (21%)
Similarity:131/337 - (38%) Gaps:61/337 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRSKSDMKPIRKEILNP----GNAYIELTPGTRVKFHFQTRRAGDSRIIDDS---------RKME 54
            ||.::.:.|.|.:..:|    ....::::....|.........||:...|.|         ..|:
Mouse    41 SRLRNGIPPSRDDCQSPYERLSQRMLDISGDRGVLKDIIREGTGDTVTPDASVLVKYSGYLEHMD 105

  Fly    55 KPME----------LVLGKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKP 109
            ||.:          :.||:...|...||.:..|...|:|:|....:      :...||       
Mouse   106 KPFDSNCFRKTPRLMKLGEDITLWGMELGLLSMRKGELARFLFKPA------YAYGTL------- 157

  Fly   110 EERRHCCGMTLQNEGIGY-TDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATST 173
                .|..:...|..:.: .:|.:.|.:....:|.  ..|.|..||:..::       .:...:|
Mouse   158 ----GCPPLIPPNATVLFEIELIDFLDSAESDKFC--ALSAEQQEQFPLQK-------VLKVAAT 209

  Fly   174 LRERGNNFYKASRFTEAETCYREAVGIV-EQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAG 237
            .||.||..::.:||.:|:..|:.|:.:: .:|...|:.|   ..|.|.:...|.|::...:|   
Mouse   210 EREFGNYLFRQNRFCDAKVRYKRALLLLHRRLATCEEQH---LVEPAVLLVLLNLSFVYLKL--- 268

  Fly   238 DFYAV-IEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSI 301
            |..|: :.:..:.|.:|.||.|||||..:| .......:..||||.....:......::.|||.:
Mouse   269 DRPAMALRYGEQALLIDKRNAKALFRCGQA-CLLLTEYERARDFLVRAQKEQPCNHDINNELKKL 332

  Fly   302 EDQQQARNVQDR 313
            ....  |:..||
Mouse   333 SSHY--RDYVDR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 17/87 (20%)
3a0801s09 150..>308 CDD:273380 40/159 (25%)
TPR repeat 173..217 CDD:276809 13/44 (30%)
TPR repeat 222..252 CDD:276809 6/30 (20%)
TPR repeat 257..285 CDD:276809 10/27 (37%)
Fkbp6XP_030110810.1 FKBP_C 86..176 CDD:365980 18/106 (17%)
TPR_12 254..315 CDD:315987 19/64 (30%)
TPR repeat 254..284 CDD:276809 6/32 (19%)
TPR repeat 289..317 CDD:276809 10/28 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.