DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and TOM70

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_014278.3 Gene:TOM70 / 855602 SGDID:S000005065 Length:617 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:51/208 - (24%)
Similarity:84/208 - (40%) Gaps:45/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 EKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAA 220
            ||:::.::          |:::||.|::..::.:|...|..|      |.|||.|          
Yeast    94 EKDKYALA----------LKDKGNQFFRNKKYDDAIKYYNWA------LELKEDP---------- 132

  Fly   221 IKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALA 285
               ....|.:.|.:..||...|:|...:.|.|.|...|.|.|||.|:.|....|.|..| |..|:
Yeast   133 ---VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFD-LSVLS 193

  Fly   286 L-----DASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXNISCVNVLLMLLVYWSSYLQRXQY 345
            |     |||::..:.:.|          |.|....:::.|.:|.........|....:..::.:.
Yeast   194 LNGDFNDASIEPMLERNL----------NKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQ 248

  Fly   346 LSLPSFLSLAVSF 358
            .:|||..|:|..|
Yeast   249 ENLPSVTSMASFF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196
3a0801s09 150..>308 CDD:273380 40/156 (26%)
TPR repeat 173..217 CDD:276809 12/43 (28%)
TPR repeat 222..252 CDD:276809 7/29 (24%)
TPR repeat 257..285 CDD:276809 11/27 (41%)
TOM70NP_014278.3 3a0801s09 1..614 CDD:273380 51/208 (25%)
TPR repeat 99..127 CDD:276809 7/43 (16%)
TPR repeat 131..161 CDD:276809 8/42 (19%)
TPR repeat 166..189 CDD:276809 10/23 (43%)
TPR repeat 330..358 CDD:276809
TPR repeat 363..391 CDD:276809
TPR repeat 396..426 CDD:276809
TPR repeat 431..459 CDD:276809
TPR repeat 465..493 CDD:276809
TPR repeat 498..537 CDD:276809
TPR repeat 542..567 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.