DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and TPR6

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_176141.1 Gene:TPR6 / 842214 AraportID:AT1G58450 Length:164 Species:Arabidopsis thaliana


Alignment Length:162 Identity:47/162 - (29%)
Similarity:80/162 - (49%) Gaps:9/162 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 MSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGIVEQLMLKEKPHDEEWQELAAIKTPLL 226
            |::.||:.|.:..:|.||..||..::..|...|.:|...:|.  .|.:..||  :::.|::....
plant     1 MNNGEKIEAANRKKEEGNLLYKTQKYERAAKKYNKAAECIEN--GKFEGGDE--KQVKALRVSCF 61

  Fly   227 LNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLK 291
            ||.|.|.|...:|...|..|:|||.::.:|||||:|||:::....:...|..|...||..|..  
plant    62 LNGAACSLKLKNFLETIVLCSEVLDIEFQNVKALYRRAQSYIEVGDLISAEMDINRALEADPE-- 124

  Fly   292 STVSKELKSIEDQQQARNVQDRIHMQKLFXNI 323
               ::|:||:....:....:......||:.|:
plant   125 ---NREVKSLYKAMKLSKAESDRRDAKLYANM 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196
3a0801s09 150..>308 CDD:273380 44/145 (30%)
TPR repeat 173..217 CDD:276809 12/43 (28%)
TPR repeat 222..252 CDD:276809 11/29 (38%)
TPR repeat 257..285 CDD:276809 10/27 (37%)
TPR6NP_176141.1 3a0801s09 5..>115 CDD:273380 36/113 (32%)
TPR repeat 10..38 CDD:276809 8/27 (30%)
TPR repeat 57..87 CDD:276809 11/29 (38%)
TPR repeat 92..120 CDD:276809 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3645
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.