DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and AT5G48570

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_199668.1 Gene:AT5G48570 / 834913 AraportID:AT5G48570 Length:578 Species:Arabidopsis thaliana


Alignment Length:321 Identity:79/321 - (24%)
Similarity:133/321 - (41%) Gaps:47/321 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRII--DDSRKMEKPMELVLGKKFKLEV 69
            :|.:.:.|:||..|..|.....|..||.....:....:.:.  ....:.|:|.|..:.::..:|.
plant   277 TDDRKVIKKILKEGEGYERPNEGAIVKLKLIGKLQDGTTVFVKKGHEEDEEPFEFKIDEEQVIEG 341

  Fly    70 WELIVQQMSLNEVAKFTVHKSLCAQYPF-ISKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDEL 133
            .|..|..|...|||..|:    ..:|.| .|::.:::...|..                      
plant   342 LEKAVMGMKKGEVALITI----SPEYAFGSSESKQELAVIPPN---------------------- 380

  Fly   134 LQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAV 198
                |.:.:.:||.|.    ..|||.|.|:..|::.|....:|.||..:||.::..|...|...|
plant   381 ----STVYYEVELVSF----IKEKESWDMNTQERIEAAGKKKEEGNVLFKAGKYARASKRYERGV 437

  Fly   199 GIVEQLMLKEKPHDEEWQELAA-IKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFR 262
            ..:|.    :...|||.::.:. :|....||.|.|:|...|:....:...:||.:|.|||||::|
plant   438 KYIEY----DSTFDEEEKKKSKDLKIACNLNDAACKLKLKDYKEAAKLSTKVLEMDSRNVKAMYR 498

  Fly   263 RAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXNI 323
            ||.|:....:...|..|...||.:|...|. |..|.|.::::.:..|.:|    .|.:.|:
plant   499 RAHAYLETADLDLAELDIKKALEIDPDNKE-VKIEYKKLKEKVKEYNKKD----AKFYSNM 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 15/70 (21%)
3a0801s09 150..>308 CDD:273380 47/158 (30%)
TPR repeat 173..217 CDD:276809 12/43 (28%)
TPR repeat 222..252 CDD:276809 9/29 (31%)
TPR repeat 257..285 CDD:276809 10/27 (37%)
AT5G48570NP_199668.1 FKBP_C 61..150 CDD:278674
FKBP_C 174..268 CDD:278674
FKBP_C 292..390 CDD:278674 21/127 (17%)
TPR_11 410..489 CDD:290150 21/82 (26%)
TPR repeat 414..438 CDD:276809 7/23 (30%)
TPR repeat 456..488 CDD:276809 9/31 (29%)
TPR_11 463..524 CDD:290150 22/60 (37%)
TPR_1 493..526 CDD:278916 12/32 (38%)
TPR repeat 493..521 CDD:276809 10/27 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.