DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and PAS1

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_566993.1 Gene:PAS1 / 824568 AraportID:AT3G54010 Length:635 Species:Arabidopsis thaliana


Alignment Length:419 Identity:93/419 - (22%)
Similarity:145/419 - (34%) Gaps:120/419 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRSK--SDMKPIRKEILNPGNAYIELTPGTRVKFHFQTR---RAGDSRIIDDSRKMEKPMELVLG 62
            |::|  ||...:.|:|||.|..:    ...|..:..:.|   ::||..:|  ....|:|.....|
plant   147 SKAKIASDDLGVIKKILNEGEGW----ESPREPYEVKARISAKSGDGHVI--FSHTEEPYFFTFG 205

  Fly    63 KKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYP------------------------------- 96
            |....:..|:.:..|:..|.|...|.|....:.|                               
plant   206 KSEVPKGLEIGIGTMARKEKAVIYVRKQYLTESPLLHIDQDLEEVHFEVELVHFIQVRDMLGDGR 270

  Fly    97 FISKTLRD-IGKKP-----EERR---HCCGMTLQNEGIGYTDLDELLQNPSDLEFI--------- 143
            .|.:.:|| .|:.|     ::.|   |..||.|..|...:.| .::..|...|||.         
plant   271 LIKRRIRDGRGEFPMDCPLQDSRLSVHYKGMLLNEEKTVFYD-SKIDNNDQPLEFSSGEGLVPEG 334

  Fly   144 ------------------------------------------IELFSIELPEQYEKERWQMSDDE 166
                                                      |||...|.|..:....:|...||
plant   335 FEMCTRLMLPGEIALVTCPPDYAYDKFPRPPGVSEGAHVQWEIELLGFETPRDWTGLNFQSIMDE 399

  Fly   167 KMLATSTLRERGNNFYKASRFTEAETCYREAVGIVEQLMLKE----KPHDE-EWQELAAIKTPLL 226
                ...:|..||..:|..:|..|:..|.:        :|:|    .|.|| |.:.....:..|.
plant   400 ----ADKIRSTGNRLFKEGKFELAKAKYEK--------VLREFNHVNPQDEDEGKIFGDTRNMLH 452

  Fly   227 LNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLK 291
            ||.|.|.|..|::...||.||:||...|.:||.|:||..|:........||.||...:.:|.|.:
plant   453 LNVAACLLKMGEWRKSIETCNKVLEAKPGHVKGLYRRGMAYIAGGEYDDARNDFNMMIKVDKSSE 517

  Fly   292 STVSKELKSIEDQQQARNVQDRIHMQKLF 320
            :..:..|..::.::|....:.|...:.||
plant   518 ADATAALLKLKQKEQEAESKARKQFKGLF 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 15/71 (21%)
3a0801s09 150..>308 CDD:273380 46/162 (28%)
TPR repeat 173..217 CDD:276809 13/48 (27%)
TPR repeat 222..252 CDD:276809 13/29 (45%)
TPR repeat 257..285 CDD:276809 10/27 (37%)
PAS1NP_566993.1 FKBP_C 44..144 CDD:278674
FKBP_C 168..257 CDD:302890 16/94 (17%)
FKBP_C 291..380 CDD:278674 13/89 (15%)
TPR_11 399..480 CDD:290150 27/92 (29%)
TPR repeat 437..478 CDD:276809 16/40 (40%)
TPR_11 451..514 CDD:290150 24/62 (39%)
TPR repeat 483..511 CDD:276809 10/27 (37%)
TPR repeat 516..543 CDD:276809 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.