| Sequence 1: | NP_001368980.1 | Gene: | CG1847 / 32144 | FlyBaseID: | FBgn0030345 | Length: | 390 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001278084.1 | Gene: | Tomm34 / 67145 | MGIID: | 1914395 | Length: | 309 | Species: | Mus musculus |
| Alignment Length: | 227 | Identity: | 50/227 - (22%) |
|---|---|---|---|
| Similarity: | 87/227 - (38%) | Gaps: | 69/227 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 108 KPEERRHCCGMTLQNEGIGYTDLDELLQNPSDL--------------------EFIIELFSIELP 152
Fly 153 EQYEKERWQM--SDDEKML-------ATST---------------LRERGNNFYKASRFTEAETC 193
Fly 194 YREAVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVK 258
Fly 259 ALFRRAKAHAGAWNPAQARRDFLDALALDASL 290 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG1847 | NP_001368980.1 | FKBP_C | 23..>92 | CDD:395196 | |
| 3a0801s09 | 150..>308 | CDD:273380 | 38/165 (23%) | ||
| TPR repeat | 173..217 | CDD:276809 | 9/58 (16%) | ||
| TPR repeat | 222..252 | CDD:276809 | 7/29 (24%) | ||
| TPR repeat | 257..285 | CDD:276809 | 9/27 (33%) | ||
| Tomm34 | NP_001278084.1 | TPR 3 | 85..118 | 9/31 (29%) | |
| TPR repeat | 85..113 | CDD:276809 | 7/26 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 158..189 | 7/30 (23%) | |||
| TPR_11 | 192..257 | CDD:290150 | 15/82 (18%) | ||
| TPR 4 | 193..226 | 8/50 (16%) | |||
| TPR repeat | 193..221 | CDD:276809 | 8/45 (18%) | ||
| TPR repeat | 226..256 | CDD:276809 | 7/29 (24%) | ||
| TPR 5 | 227..260 | 9/32 (28%) | |||
| TPR_1 | 229..260 | CDD:278916 | 9/30 (30%) | ||
| TPR 6 | 261..294 | 12/34 (35%) | |||
| TPR 1 | 9..42 | ||||
| TPR repeat | 9..37 | CDD:276809 | |||
| TPR_11 | 10..82 | CDD:290150 | |||
| TPR_11 | 50..115 | CDD:290150 | 9/28 (32%) | ||
| TPR repeat | 50..80 | CDD:276809 | |||
| TPR 2 | 51..84 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1535 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.940 | |||||