DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and FKBP10

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_011523401.1 Gene:FKBP10 / 60681 HGNCID:18169 Length:601 Species:Homo sapiens


Alignment Length:196 Identity:36/196 - (18%)
Similarity:66/196 - (33%) Gaps:58/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EILNPGNAY----IELTPGTRVKFHFQTRRAG--------------DSRIIDDSRKMEKPMELVL 61
            ::.||.:|.    :||.||.       .||||              |..:.|.|..........:
Human   260 DVHNPKDAVQLETLELPPGC-------VRRAGAGDFMRYHYNGSLMDGTLFDSSYSRNHTYNTYI 317

  Fly    62 GKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKK-PEERRHCCGMTLQNEGI 125
            |:.:.:...:..:|...:.|..:.|:.       |.::......|.| |       |..:....:
Human   318 GQGYIIPGMDQGLQGACMGERRRITIP-------PHLAYGENGTGDKIP-------GSAVLIFNV 368

  Fly   126 GYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSD-----------DEKMLATSTLRERGN 179
            ...|    ..||:|   ::|:.::..|.:...|..::.|           |...|.||...:.|:
Human   369 HVID----FHNPAD---VVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSGETDAGS 426

  Fly   180 N 180
            :
Human   427 H 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 15/86 (17%)
3a0801s09 150..>308 CDD:273380 8/42 (19%)
TPR repeat 173..217 CDD:276809 1/8 (13%)
TPR repeat 222..252 CDD:276809
TPR repeat 257..285 CDD:276809
FKBP10XP_011523401.1 FKBP_C 55..147 CDD:278674
FKBP_C 167..259 CDD:278674
FKBP_C 279..371 CDD:278674 16/112 (14%)
FKBP_C 392..502 CDD:278674 7/36 (19%)
EF-hand_7 523..587 CDD:290234
EFh 525..586 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.