Sequence 1: | NP_001368980.1 | Gene: | CG1847 / 32144 | FlyBaseID: | FBgn0030345 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011523401.1 | Gene: | FKBP10 / 60681 | HGNCID: | 18169 | Length: | 601 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 36/196 - (18%) |
---|---|---|---|
Similarity: | 66/196 - (33%) | Gaps: | 58/196 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 EILNPGNAY----IELTPGTRVKFHFQTRRAG--------------DSRIIDDSRKMEKPMELVL 61
Fly 62 GKKFKLEVWELIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKK-PEERRHCCGMTLQNEGI 125
Fly 126 GYTDLDELLQNPSDLEFIIELFSIELPEQYEKERWQMSD-----------DEKMLATSTLRERGN 179
Fly 180 N 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1847 | NP_001368980.1 | FKBP_C | 23..>92 | CDD:395196 | 15/86 (17%) |
3a0801s09 | 150..>308 | CDD:273380 | 8/42 (19%) | ||
TPR repeat | 173..217 | CDD:276809 | 1/8 (13%) | ||
TPR repeat | 222..252 | CDD:276809 | |||
TPR repeat | 257..285 | CDD:276809 | |||
FKBP10 | XP_011523401.1 | FKBP_C | 55..147 | CDD:278674 | |
FKBP_C | 167..259 | CDD:278674 | |||
FKBP_C | 279..371 | CDD:278674 | 16/112 (14%) | ||
FKBP_C | 392..502 | CDD:278674 | 7/36 (19%) | ||
EF-hand_7 | 523..587 | CDD:290234 | |||
EFh | 525..586 | CDD:238008 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |