DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and fkbp8

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_957178.1 Gene:fkbp8 / 393858 ZFINID:ZDB-GENE-040426-1849 Length:406 Species:Danio rerio


Alignment Length:321 Identity:78/321 - (24%)
Similarity:129/321 - (40%) Gaps:57/321 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IRKEILNPGNAYIELTP--GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELIV 74
            :||::|..| |..:..|  |..|..|.:|... :..::|:.    |.:...||....|:..:|.|
Zfish    94 LRKKVLEAG-AGPDSRPQKGQNVTIHLKTALT-NGTVVDEL----KDLSFTLGDGDVLQALDLTV 152

  Fly    75 QQMSLNE------VAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDEL 133
            |.|.:.|      .||: .:.:|.:..|.:                                   
Zfish   153 QLMEMGEKALIEAAAKY-AYGALGSSAPAV----------------------------------- 181

  Fly   134 LQNPSDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAV 198
               |.|.:.::|:..:...|..:.|  .|...|:::..:..|||||..|:.:.:..|...|..|:
Zfish   182 ---PPDADLLLEVQLLSADEALDLE--LMPPSERIILANRKRERGNVHYQRADYAFAVNSYGIAL 241

  Fly   199 GIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRR 263
            .|.|.....:...:|| :||..:|...|.|.|..:|....:.|.:..|..||...|.|||||||:
Zfish   242 QITEASSRVDISQEEE-EELLDMKVKCLNNMAAAQLKLDHYEAALRSCVSVLAHQPDNVKALFRK 305

  Fly   264 AKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXNIS 324
            .|..|.....|:|.:....||.|:.|.| |:..||..:..:...:...::...:|:..|.|
Zfish   306 GKVLALQGEFAEAIKTLKMALKLEPSNK-TIHAELSKLVKKHSEQKGAEQAMYKKMLGNPS 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 17/76 (22%)
3a0801s09 150..>308 CDD:273380 48/157 (31%)
TPR repeat 173..217 CDD:276809 13/43 (30%)
TPR repeat 222..252 CDD:276809 9/29 (31%)
TPR repeat 257..285 CDD:276809 11/27 (41%)
fkbp8NP_957178.1 FKBP_C 106..194 CDD:278674 22/131 (17%)
TPR_11 214..296 CDD:290150 24/82 (29%)
TPR repeat 214..259 CDD:276809 13/45 (29%)
TPR repeat 265..293 CDD:276809 7/27 (26%)
TPR_11 266..330 CDD:290150 23/63 (37%)
TPR repeat 298..328 CDD:276809 13/29 (45%)
TPR_1 299..332 CDD:278916 13/32 (41%)
TPR repeat 333..361 CDD:276809 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.