DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and Fkbp5

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_006256284.1 Gene:Fkbp5 / 361810 RGDID:1309155 Length:473 Species:Rattus norvegicus


Alignment Length:415 Identity:88/415 - (21%)
Similarity:152/415 - (36%) Gaps:125/415 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKSDMKPIRKEILNPGNAYIELTP--GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKL 67
            :|.| :.:.|.:...|.:  |.||  |.:|..|::.:.:...: .|.||...:|....|||...:
  Rat    44 TKKD-RGVLKIVKRVGTS--EETPMIGDKVYVHYKGKLSNGKK-FDSSRDRNEPFVFSLGKGQVI 104

  Fly    68 EVWELIVQQMSLNEVAKFTVHKSLC-AQYP----------------FISKTLRDIGKKPEERRHC 115
            :.|::.|..|...|:...     || .:|.                |....|.|.  |.|:....
  Rat   105 KAWDIGVSTMKKGEICHL-----LCKPEYAYGSAGSLPKIPSNATLFFEIELLDF--KGEDLFED 162

  Fly   116 CGM--TLQNEGIGYTDLDELLQNPS---------------------DLEFII------------- 144
            .|:  .::.:|.||:       ||:                     |:.|:|             
  Rat   163 SGIIRRIKRKGEGYS-------NPNEGATVEVHLEGCCAGRVFDCRDVVFVIGEGEDHDIPIGID 220

  Fly   145 -ELFSIELPEQ----------------------------YE---------KERWQMSDDEKMLAT 171
             .|..::..||                            ||         ||.|:|...||:...
  Rat   221 KALEKMQREEQCILYLGPQYGFGEAGKPKFGIEPNAELMYEVTLKSFEKAKESWEMDTKEKLEQA 285

  Fly   172 STLRERGNNFYKASRFTEAETCYREAVGIVEQ---LMLKEKPHDEEWQELAAIKTPLLLNYAQCR 233
            :.::|:|..::|..::.:|...|.:.|..:|.   |..||....|.:. |||     .||.|.|.
  Rat   286 AIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFL-LAA-----FLNLAMCY 344

  Fly   234 LIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKEL 298
            |...::...:|.|::.|.||..|.|.|:||.:|.........|:.||...|.::...|: ...::
  Rat   345 LKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKA-ARLQI 408

  Fly   299 KSIEDQQQARNVQDRIHMQKLFXNI 323
            ...:.:.:..|.:||    :::.|:
  Rat   409 SVCQRKAKEHNERDR----RVYANM 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 17/70 (24%)
3a0801s09 150..>308 CDD:273380 45/197 (23%)
TPR repeat 173..217 CDD:276809 11/46 (24%)
TPR repeat 222..252 CDD:276809 8/29 (28%)
TPR repeat 257..285 CDD:276809 8/27 (30%)
Fkbp5XP_006256284.1 FKBP_C 61..152 CDD:278674 21/96 (22%)
TPR_11 284..364 CDD:290150 22/85 (26%)
TPR repeat 285..313 CDD:276809 5/27 (19%)
TPR_11 336..399 CDD:290150 21/67 (31%)
TPR 336..367 CDD:197478 11/35 (31%)
TPR repeat 336..362 CDD:276809 8/30 (27%)
TPR repeat 367..397 CDD:276809 10/29 (34%)
TPR_1 369..401 CDD:278916 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.