DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and Tom70

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_609536.1 Gene:Tom70 / 34618 FlyBaseID:FBgn0032397 Length:589 Species:Drosophila melanogaster


Alignment Length:192 Identity:51/192 - (26%)
Similarity:78/192 - (40%) Gaps:50/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 IELFSIEL----PEQYEKERWQMSDD--EKMLATSTLRE------RGNNFYKASRFTEAETCYRE 196
            ||..:|.|    |:| |.||.|.|.:  ||:   |.|:|      .|||.|:..::.||...|.:
  Fly    55 IEKQAISLDGTAPDQ-ELERNQKSAELGEKL---SPLKEANNYKTEGNNCYRNGKYDEAIKFYDK 115

  Fly   197 AVGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALF 261
            |:         :|...|...::|........:|...:    .:..|.|.|...|..:||..||.:
  Fly   116 AI---------DKCPKEHRTDMAIFYQNRAASYEMLK----KWSNVKEDCTASLEFNPRYAKAYY 167

  Fly   262 RRAKAHAGAWNPAQARRDF---LDALALDASLK-----------STVSKELKSIEDQQQARN 309
            |||:||       :|.:|.   ||.:.....|:           ..|.||...::.::..||
  Fly   168 RRARAH-------EATKDMNECLDDVTATCILEMFQNNQTIMFADRVLKETGRLDAEKGMRN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196
3a0801s09 150..>308 CDD:273380 46/183 (25%)
TPR repeat 173..217 CDD:276809 12/49 (24%)
TPR repeat 222..252 CDD:276809 5/29 (17%)
TPR repeat 257..285 CDD:276809 11/30 (37%)
Tom70NP_609536.1 TPR_11 89..160 CDD:290150 17/83 (20%)
TPR repeat 90..118 CDD:276809 8/36 (22%)
TPR repeat 123..158 CDD:276809 7/38 (18%)
TPR repeat 296..324 CDD:276809
TPR_11 333..399 CDD:290150
TPR repeat 334..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR repeat 402..437 CDD:276809
TPR_16 413..477 CDD:290168
TPR repeat 443..471 CDD:276809
TPR repeat 476..507 CDD:276809
TPR_11 486..539 CDD:290150
TPR repeat 512..539 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.