DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1847 and Tomm70a

DIOPT Version :9

Sequence 1:	NP_001368980.1	Gene:	CG1847 / 32144	FlyBaseID:	FBgn0030345	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_613065.2	Gene:	Tomm70a / 28185	MGIID:	106295	Length:	611	Species:	Mus musculus

Alignment Length:	138	Identity:	34/138 - (24%)
Similarity:	56/138 - (40%)	Gaps:	54/138 - (39%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 QMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGI-------------------VEQLML 206
            :||..::..|.   :.:||.::||.::.:|..||.||:.:                   .|||
Mouse   110 EMSSLDRAQAA---KNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQL-- 169

  Fly   207 KEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAW 271
                  ::|:|:|                        :.|.:.:.|:|:.|||||||||||....
Mouse   170 ------QKWKEVA------------------------QDCTKAVELNPKYVKALFRRAKAHEKLD 204

  Fly   272 NPAQARRD 279
            |..:...|
Mouse   205 NKKECLED 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1847	NP_001368980.1	FKBP_C	23..>92	CDD:395196
		3a0801s09	150..>308	CDD:273380	34/138 (25%)
		TPR repeat	173..217	CDD:276809	13/62 (21%)
		TPR repeat	222..252	CDD:276809	1/29 (3%)
		TPR repeat	257..285	CDD:276809	13/23 (57%)
Tomm70a	NP_613065.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	69..110		34/138 (25%)
		PLN03088	<117..604	CDD:330826	32/131 (24%)
		TPR 1	117..150		10/35 (29%)
		TPR repeat	117..145	CDD:276809	10/30 (33%)
		TPR repeat	155..185	CDD:276809	7/61 (11%)
		TPR 2	156..189		9/64 (14%)
		TPR 3	297..330
		TPR 4	332..365
		TPR repeat	332..360	CDD:276809
		TPR repeat	365..399	CDD:276809
		TPR 5	370..403
		TPR 6	404..437
		TPR repeat	404..432	CDD:276809
		TPR 7	445..478
		TPR repeat	447..473	CDD:276809
		TPR 8	479..512
		TPR repeat	479..507	CDD:276809
		TPR repeat	512..543	CDD:276809
		TPR 9	514..547
		TPR 10	548..581
		TPR repeat	548..575	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R1535
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030