DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and FKBP5

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001139247.1 Gene:FKBP5 / 2289 HGNCID:3721 Length:457 Species:Homo sapiens


Alignment Length:407 Identity:89/407 - (21%)
Similarity:153/407 - (37%) Gaps:109/407 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SKSDMKPIRKEILNPGNAYIELTP--GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKL 67
            ||.| :.:.|.:...||.  |.||  |.:|..|::.:.:...: .|.|....:|....|||...:
Human    27 SKKD-RGVLKIVKRVGNG--EETPMIGDKVYVHYKGKLSNGKK-FDSSHDRNEPFVFSLGKGQVI 87

  Fly    68 EVWELIVQQMSLNEVAKFTVHKSLC-AQYPFIS----------KTL---------------RDIG 106
            :.|::.|..|...|:...     || .:|.:.|          .||               .|.|
Human    88 KAWDIGVATMKKGEICHL-----LCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGG 147

  Fly   107 KKPEERRHCCGMTLQNEG--------------------IGYT-----------DLDELLQNPSDL 140
            .....:|...|.:..|||                    :.:|           .:|:.|:.....
Human   148 IIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQRE 212

  Fly   141 E-------------------FIIE-----LFSIELPEQYE--KERWQMSDDEKMLATSTLRERGN 179
            |                   |.||     ::.:.| :.:|  ||.|:|...||:...:.::|:|.
Human   213 EQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTL-KSFEKAKESWEMDTKEKLEQAAIVKEKGT 276

  Fly   180 NFYKASRFTEAETCYREAVGIVEQ---LMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYA 241
            .::|..::.:|...|.:.|..:|.   |..||....|.:. |||     .||.|.|.|...::..
Human   277 VYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFL-LAA-----FLNLAMCYLKLREYTK 335

  Fly   242 VIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQ 306
            .:|.|::.|.||..|.|.|:||.:|.........|:.||...|.::...|: ...::...:.:.:
Human   336 AVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKA-ARLQISMCQKKAK 399

  Fly   307 ARNVQDRIHMQKLFXNI 323
            ..|.:||    ::: |:
Human   400 EHNERDR----RIYANM 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 16/70 (23%)
3a0801s09 150..>308 CDD:273380 43/162 (27%)
TPR repeat 173..217 CDD:276809 11/46 (24%)
TPR repeat 222..252 CDD:276809 8/29 (28%)
TPR repeat 257..285 CDD:276809 8/27 (30%)
FKBP5NP_001139247.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..135 CDD:278674 22/99 (22%)
TPR_11 267..347 CDD:290150 22/85 (26%)
TPR 1 268..301 7/32 (22%)
TPR repeat 268..296 CDD:276809 5/27 (19%)
TPR 2 317..350 13/37 (35%)
TPR_11 319..382 CDD:290150 21/67 (31%)
TPR 319..350 CDD:197478 11/35 (31%)
TPR repeat 319..345 CDD:276809 8/30 (27%)
TPR repeat 350..380 CDD:276809 10/29 (34%)
TPR 3 351..384 9/32 (28%)
TPR_1 352..384 CDD:278916 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..457
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.