DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and FKBP4

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_002005.1 Gene:FKBP4 / 2288 HGNCID:3720 Length:459 Species:Homo sapiens


Alignment Length:391 Identity:98/391 - (25%)
Similarity:138/391 - (35%) Gaps:122/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELIVQQMSLNEVAKFTVHKSLC- 92
            |.||..|: |....|....|.|...:......|||...::.|::.:..|.:.||...|     | 
Human    50 GDRVFVHY-TGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVGEVCHIT-----CK 108

  Fly    93 AQYPFISKTLRDIGKKP-----------------------EERRHCCGMTLQNEGIGYT------ 128
            .:|.:.|     .|..|                       ||........:|..|.||.      
Human   109 PEYAYGS-----AGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGA 168

  Fly   129 ---------------DLDEL---------LQNPSDLEFII------------------------E 145
                           |..||         |..|..||..|                        |
Human   169 IVEVALEGYYKDKLFDQRELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKE 233

  Fly   146 LFSI----ELPEQYE---------KERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREA 197
            .|.|    ||  :||         ||.|:|:.:||:..::.::|||..::|..::.:|...|:: 
Human   234 KFQIPPNAEL--KYELHLKSFEKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKK- 295

  Fly   198 VGIVEQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFR 262
              ||..|..:....:||.|:..|::....||.|.|.|....|.|.||.||:.|.||..|.|.|||
Human   296 --IVSWLEYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFR 358

  Fly   263 RAKAHAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQ-----KLFXN 322
            |.:||....:...||.||...|.|..:.|:.          :.|....|.||..|     ||: |
Human   359 RGEAHLAVNDFELARADFQKVLQLYPNNKAA----------KTQLAVCQQRIRRQLAREKKLYAN 413

  Fly   323 I 323
            :
Human   414 M 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 16/62 (26%)
3a0801s09 150..>308 CDD:273380 53/166 (32%)
TPR repeat 173..217 CDD:276809 11/43 (26%)
TPR repeat 222..252 CDD:276809 12/29 (41%)
TPR repeat 257..285 CDD:276809 11/27 (41%)
FKBP4NP_002005.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
FKBP_C 43..134 CDD:306713 21/94 (22%)
FKBP_N <155..254 CDD:332399 19/100 (19%)
TPR_11 <250..>395 CDD:330823 49/157 (31%)
Interaction with tubulin. /evidence=ECO:0000250 267..400 44/145 (30%)
TPR repeat 274..301 CDD:276809 8/29 (28%)
TPR repeat 306..348 CDD:276809 16/41 (39%)
TPR repeat 353..381 CDD:276809 11/27 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 421..459
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.