DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and fkb-4

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_506197.1 Gene:fkb-4 / 179752 WormBaseID:WBGene00001429 Length:259 Species:Caenorhabditis elegans


Alignment Length:119 Identity:24/119 - (20%)
Similarity:48/119 - (40%) Gaps:13/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IRKEILNPGNAYIELTPGTRVKFHFQ-----TRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWE 71
            |||.::.|...:.:.:.|..:.:..|     ....|:..:.::..::::..::...|..|.|..:
 Worm   103 IRKVVIPPKLGFAKDSTGQPLYYTVQLVNLFRANPGERWVTEEGIQIDQIHKIEADKCKKAEAGD 167

  Fly    72 LIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNEGI 125
            .|.||..|.......|..|.....||:.: ||:       |....||.:..:|:
 Worm   168 KIYQQYVLRLEDNTLVDSSYSRNAPFVFR-LRN-------REVIDGMDIAMDGM 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 12/73 (16%)
3a0801s09 150..>308 CDD:273380
TPR repeat 173..217 CDD:276809
TPR repeat 222..252 CDD:276809
TPR repeat 257..285 CDD:276809
fkb-4NP_506197.1 FKBP_C 45..130 CDD:278674 6/26 (23%)
FKBP_C 161..250 CDD:278674 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.