Sequence 1: | NP_001368980.1 | Gene: | CG1847 / 32144 | FlyBaseID: | FBgn0030345 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034350.1 | Gene: | Fkbp5 / 14229 | MGIID: | 104670 | Length: | 456 | Species: | Mus musculus |
Alignment Length: | 379 | Identity: | 82/379 - (21%) |
---|---|---|---|
Similarity: | 145/379 - (38%) | Gaps: | 100/379 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 GTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWELIVQQMSLNEVA---------- 83
Fly 84 -------KFTVHKSLCAQYPFI----------SKTLRDIGKK------PEE----RRH---CCG- 117
Fly 118 ----------------------------MTLQNE-----------GIGYTDLDELLQNP-SDLEF 142
Fly 143 IIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGIVEQ---L 204
Fly 205 MLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAG 269
Fly 270 AWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXNI 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG1847 | NP_001368980.1 | FKBP_C | 23..>92 | CDD:395196 | 15/79 (19%) |
3a0801s09 | 150..>308 | CDD:273380 | 44/160 (28%) | ||
TPR repeat | 173..217 | CDD:276809 | 13/46 (28%) | ||
TPR repeat | 222..252 | CDD:276809 | 8/29 (28%) | ||
TPR repeat | 257..285 | CDD:276809 | 8/27 (30%) | ||
Fkbp5 | NP_034350.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..24 | ||
FKBP_C | 44..135 | CDD:278674 | 16/85 (19%) | ||
TPR_11 | 267..347 | CDD:290150 | 24/85 (28%) | ||
TPR 1 | 268..301 | 9/32 (28%) | |||
TPR repeat | 268..296 | CDD:276809 | 7/27 (26%) | ||
TPR 2 | 317..350 | 13/37 (35%) | |||
TPR_11 | 319..382 | CDD:290150 | 22/67 (33%) | ||
TPR | 319..350 | CDD:197478 | 11/35 (31%) | ||
TPR repeat | 319..345 | CDD:276809 | 8/30 (27%) | ||
TPR repeat | 350..380 | CDD:276809 | 10/29 (34%) | ||
TPR 3 | 351..384 | 10/32 (31%) | |||
TPR_1 | 352..384 | CDD:278916 | 10/31 (32%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 421..456 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |