DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and FKBP9

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001271270.1 Gene:FKBP9 / 11328 HGNCID:3725 Length:623 Species:Homo sapiens


Alignment Length:151 Identity:28/151 - (18%)
Similarity:50/151 - (33%) Gaps:43/151 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SDMKPIRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEVWE 71
            |..||....:|:....|:        |:|:..... |..::|.:..:.|...:|||....:...:
Human   428 SHYKPPDCSVLSKKGDYL--------KYHYNASLL-DGTLLDSTWNLGKTYNIVLGSGQVVLGMD 483

  Fly    72 LIVQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDELLQN 136
            :.:::|.:.|.....:...|                                |.|...:|..:..
Human   484 MGLREMCVGEKRTVIIPPHL--------------------------------GYGEAGVDGEVPG 516

  Fly   137 PSDLEFIIELFSI--ELPEQY 155
            .:.|.|.|||..:  .|||.|
Human   517 SAVLVFDIELLELVAGLPEGY 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 11/68 (16%)
3a0801s09 150..>308 CDD:273380 4/6 (67%)
TPR repeat 173..217 CDD:276809
TPR repeat 222..252 CDD:276809
TPR repeat 257..285 CDD:276809
FKBP9NP_001271270.1 FKBP_C 47..191 CDD:278674
FKBP_C 212..304 CDD:278674
FKBP_C 324..415 CDD:278674
FKBP_C 435..527 CDD:278674 20/132 (15%)
EF-hand_7 548..612 CDD:290234
EFh 550..611 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.