DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and fkbp4

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_012810222.1 Gene:fkbp4 / 100379681 XenbaseID:XB-GENE-948088 Length:450 Species:Xenopus tropicalis


Alignment Length:317 Identity:83/317 - (26%)
Similarity:133/317 - (41%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IRKEILNPGNAYIELTPGTRVKFHFQTRRAGDSRIIDDSRKMEKPMELVLGKKFKLEV---WELI 73
            |.:.|...|..|.:...|..|:.|.:....|  |:.|     |:.::..:|:...:.:   .|..
 Frog   146 IIRRIQVKGEGYSKPNEGAVVEIHVKGTHEG--RVFD-----ERELKFEVGEGESIGIPPGVETA 203

  Fly    74 VQQMSLNEVAKFTVHKSLCAQYPFISKTLRDIGKKPEERRHCCGMTLQNEGIGYTDLDELLQNP- 137
            :|||...|.|...:                    ||:            .|.|.|. .|..|.| 
 Frog   204 IQQMEKGEKAILYL--------------------KPK------------YGFGTTG-SEKYQIPP 235

  Fly   138 -SDLEFIIELFSIELPEQYEKERWQMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGIV 201
             ::|::.|.|.|.|    ..||.|:|:.:||:.....::|||..::|..|:.:|...|::.:..:
 Frog   236 GAELQYDIRLKSFE----KAKESWEMNAEEKLEQGCLVKERGTQYFKDGRYRQATIQYKKIIQWL 296

  Fly   202 EQLMLKEKPHDEEWQELAAIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKA 266
            |......|..|.:.:.|....:   ||.|.|.|..|:..|.::|||:.|.|||.|.|.||||.:|
 Frog   297 EHESGLSKEEDAKAKSLILAAS---LNLAACYLKLGEHRAALDHCNKALELDPSNEKGLFRRGEA 358

  Fly   267 HAGAWNPAQARRDFLDALALDASLKSTVSKELKSIEDQQQARNVQDRIHMQKLFXNI 323
            :....:..|||.||...|.|     ...:|..::...|.|.|..|.....:|:: |:
 Frog   359 YMCTNDLEQARNDFTKVLQL-----YPANKAARAQLGQCQVRIRQQTEREKKIYANM 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196 15/71 (21%)
3a0801s09 150..>308 CDD:273380 49/157 (31%)
TPR repeat 173..217 CDD:276809 10/43 (23%)
TPR repeat 222..252 CDD:276809 11/29 (38%)
TPR repeat 257..285 CDD:276809 11/27 (41%)
fkbp4XP_012810222.1 FKBP_C 39..130 CDD:365980
FKBP_C 156..246 CDD:365980 25/129 (19%)
TPR <237..380 CDD:223533 50/154 (32%)
TPR repeat 270..294 CDD:276809 7/23 (30%)
TPR repeat 307..344 CDD:276809 13/39 (33%)
TPR repeat 349..377 CDD:276809 11/27 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.