DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1847 and tomm70

DIOPT Version :9

Sequence 1:NP_001368980.1 Gene:CG1847 / 32144 FlyBaseID:FBgn0030345 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001096527.1 Gene:tomm70 / 100125169 XenbaseID:XB-GENE-1007952 Length:577 Species:Xenopus tropicalis


Alignment Length:125 Identity:39/125 - (31%)
Similarity:60/125 - (48%) Gaps:28/125 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 QMSDDEKMLATSTLRERGNNFYKASRFTEAETCYREAVGIVEQLMLKEKPHDEE------WQELA 219
            ::|..||..|.   :.:||.::|||::.:|..||.||:.:.        |.|.:      :|..|
 Frog    76 ELSPLEKAQAA---KNKGNKYFKASKYEQAIQCYTEAISLC--------PVDTKSDLSTFYQNRA 129

  Fly   220 AIKTPLLLNYAQCRLIAGDFYAVIEHCNEVLTLDPRNVKALFRRAKAHAGAWNPAQARRD 279
            |.... |.|:.:          |::.|.:.:.|:||.|||||||||||....|..:...|
 Frog   130 AAHEQ-LQNWKE----------VVQDCTKAVELNPRYVKALFRRAKAHERLDNKKECLED 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1847NP_001368980.1 FKBP_C 23..>92 CDD:395196
3a0801s09 150..>308 CDD:273380 39/125 (31%)
TPR repeat 173..217 CDD:276809 12/49 (24%)
TPR repeat 222..252 CDD:276809 4/29 (14%)
TPR repeat 257..285 CDD:276809 13/23 (57%)
tomm70NP_001096527.1 3a0801s09 20..570 CDD:273380 39/125 (31%)
TPR repeat 83..111 CDD:276809 11/30 (37%)
TPR repeat 116..151 CDD:276809 8/45 (18%)
TPR repeat 298..326 CDD:276809
TPR repeat 331..365 CDD:276809
TPR repeat 370..398 CDD:276809
TPR repeat 404..438 CDD:276809
TPR repeat 445..473 CDD:276809
TPR repeat 478..509 CDD:276809
TPR repeat 514..541 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1535
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.