DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and EMP24

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_011315.3 Gene:EMP24 / 852675 SGDID:S000003168 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:47/181 - (25%)
Similarity:74/181 - (40%) Gaps:31/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CFYEEIKKNSSAYFEFQV-----SAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFV---AETTG 89
            ||:|::.|.......||.     .:..||..|..:..|:...:....:.|  ||..:   |...|
Yeast    32 CFFEDLSKGDELSISFQFGDRNPQSSSQLTGDFIIYGPERHEVLKTVRDT--SHGEITLSAPYKG 94

  Fly    90 VYTACFGNQFSAFS--------HKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDI 146
            .:..||.|:.:...        |.:||||           :|:..|  ..::::.:.:.|...::
Yeast    95 HFQYCFLNENTGIETKDVTFNIHGVVYVD-----------LDDPNT--NTLDSAVRKLSKLTREV 146

  Fly   147 LDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFF 197
            .|.|::..:||...|..||..|.||..||..:...||...|.||..||.||
Yeast   147 KDEQSYIVIRERTHRNTAESTNDRVKWWSIFQLGVVIANSLFQIYYLRRFF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 45/179 (25%)
EMP24NP_011315.3 EMP24_GP25L 20..198 CDD:395878 47/181 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.