DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and ERP3

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_010266.1 Gene:ERP3 / 851544 SGDID:S000002176 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:43/204 - (21%)
Similarity:74/204 - (36%) Gaps:24/204 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVEFTFDLADNAVDCFY---EEIKKNSSAYFEFQVSAGGQLDV--DVTLKDPQGKVIYSLEKATF 78
            |...||:|.....:|.|   .||....|.||..|.......||  ::...|.:.|.|........
Yeast    21 ASPLTFELNKGRKECLYTLTPEIDCTISYYFAVQQGESNDFDVNYEIFAPDDKNKPIIERSGERQ 85

  Fly    79 DSHQFVAETTGVYTACFGNQFSAFSH-KIVYVDFQVGEE-------------PALPGVDEHAT-- 127
            ....|:.:..|.|..||   :...:| |||.:||:...|             .|...:.:..|  
Yeast    86 GEWSFIGQHKGEYAICF---YGGKAHDKIVDLDFKYNCERQDDIRNERRKARKAQRNLRDSKTDP 147

  Fly   128 VLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMV 192
            :...:|.|...|.:.|:.:.....:::.|..:..........|::::|......:|.:...||.:
Yeast   148 LQDSVENSIDTIERQLHVLERNIQYYKSRNTRNHHTVCSTEHRIVMFSIYGILLIIGMSCAQIAI 212

  Fly   193 LRNFFTDRK 201
            |...|.:.:
Yeast   213 LEFIFRESR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 41/196 (21%)
ERP3NP_010266.1 EMP24_GP25L 23..218 CDD:395878 41/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103696
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.