DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed10

DIOPT Version :10

Sequence 1:NP_572754.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_445919.1 Gene:Tmed10 / 84599 RGDID:620970 Length:219 Species:Rattus norvegicus


Alignment Length:198 Identity:53/198 - (26%)
Similarity:87/198 - (43%) Gaps:23/198 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SAVEFTFDLADNAVDCFYEEIKKN---SSAYFEFQVSAG-GQLDVDVTLKDPQGKVIYSLEKATF 78
            |.:..:|.|..|:..|..|||.|:   :.||.....|.| |.|...:.:.|..|.::|:.|.||.
  Rat    28 SVLGISFHLPVNSRKCLREEIHKDLLVTGAYEITDQSGGAGGLRTHLKITDSAGHILYAKEDATK 92

  Fly    79 DSHQFVAETTGVYTACFGNQFSA-FSHKIVYVDFQVGEEPALPGVDEHATV---------LTQME 133
            ....|..|...::..||.::.:. ...::|.:|.:.|.|  ....:|.|.|         |.::|
  Rat    93 GKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVE--AKNYEEIAKVEKLKPLEVELRRLE 155

  Fly   134 TSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFT 198
            ..|::|   :||.    .:.:.||.:.|...|..|.||:.:|......:|.:...|:..||.||.
  Rat   156 DLSESI---VNDF----AYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFK 213

  Fly   199 DRK 201
            .:|
  Rat   214 AKK 216

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_572754.1 EMP24_GP25L 21..197 CDD:426051 49/189 (26%)
Tmed10NP_445919.1 Required for interaction with STX17. /evidence=ECO:0000250 1..142 31/115 (27%)
EMP24_GP25L 31..213 CDD:426051 50/190 (26%)
Required for TMED10 and TMED2 cis-Golgi network localization. /evidence=ECO:0000250 147..178 9/37 (24%)
Interaction with COPG1. /evidence=ECO:0000250 204..219 6/13 (46%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000250|UniProtKB:P49755 207..219 5/10 (50%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..219 3/6 (50%)