DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and AT3G22845

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_188924.3 Gene:AT3G22845 / 821856 AraportID:AT3G22845 Length:214 Species:Arabidopsis thaliana


Alignment Length:143 Identity:33/143 - (23%)
Similarity:65/143 - (45%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGV 122
            :|.|:..|.|.::.:|:..:.|..:|.|..:|:|..||.|.:|.......|:  .||..|....:
plant    69 LDFTVTSPAGNIVQTLKGTSGDKFEFKAPKSGMYKFCFHNPYSTPETVSFYI--HVGHIPNEHDL 131

  Fly   123 --DEHATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVI 185
              |||   |..:......:.:.|..::..|.:.:.|:.:.|...|...:||:.::..|...:...
plant   132 AKDEH---LDPVNVKIAELREALESVVAEQKYLKARDTRHRHTNESTRKRVIFYTVGEYIFLAAA 193

  Fly   186 GLVQIMVLRNFFT 198
            ..:|::.:|..|:
plant   194 SGLQVLYIRKLFS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 32/140 (23%)
AT3G22845NP_188924.3 EMP24_GP25L 33..205 CDD:395878 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - mtm1213
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.