DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_012820011.1 Gene:tmed2 / 734103 XenbaseID:XB-GENE-986353 Length:208 Species:Xenopus tropicalis


Alignment Length:211 Identity:58/211 - (27%)
Similarity:96/211 - (45%) Gaps:31/211 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VALMMHCI---SAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIY 71
            |||:  |.   :|..:...:..:|.:||:|::...:.....|:|:.||.||:||.:..|..|.|:
 Frog     8 VALL--CFFSATASGYFVSIDAHAEECFFEQVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIH 70

  Fly    72 SLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEP-----ALPGV----DEHAT 127
            ..::.:...:.|.|...|.|..||.|:.|..:.|||.....:||.|     ...|:    |.|..
 Frog    71 KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGIGESWDAHQN 135

  Fly   128 VLTQMETSSQAIHKGLNDILDAQT-------HHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVI 185
            .|.:|          :|::..|.|       :..:||...|...::.|.||::||..|...::.:
 Frog   136 KLEEM----------INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVLVAM 190

  Fly   186 GLVQIMVLRNFFTDRK 201
            .|.||..|:.||..|:
 Frog   191 TLGQIYYLKRFFEVRR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 50/191 (26%)
tmed2XP_012820011.1 EMP24_GP25L 23..203 CDD:366467 51/189 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.