DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed11

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_001071744.1 Gene:Tmed11 / 689712 RGDID:1588776 Length:214 Species:Rattus norvegicus


Alignment Length:222 Identity:50/222 - (22%)
Similarity:94/222 - (42%) Gaps:31/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTQIVVFAVALMMHCIS---AVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV------------ 50
            |.||.::.       |.|   :..|.|...:....|..|:|..::.....|::            
  Rat     1 MQTQTILL-------CFSFSFSAAFYFHAGEREEKCIIEDIPSDTLITGTFKIQQWDIGRHDFLE 58

  Fly    51 SAGG-QLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACF---GNQFSAF--SHKIVYV 109
            ||.| .:.|.||..|   :|:.|.......:..|.:.::|.:..|.   ..||.:|  |...:::
  Rat    59 SAPGLGMFVTVTNND---EVLLSKLYGAQGTFYFTSHSSGEHIICLESNSTQFVSFGGSKLRIHL 120

  Fly   110 DFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVW 174
            |.:|||......:.:....:.::..:.:.:.:.:..||..|.:.|.||...|..:||.|:.|:.|
  Rat   121 DIRVGEHDLDAVIVQAKDKVNEVAFTLRHLIEQIEQILKEQDYQRDREENFRITSEDTNRNVLWW 185

  Fly   175 SSLETAAVIVIGLVQIMVLRNFFTDRK 201
            :..:....|.:|:.|:..|::||..:|
  Rat   186 AFAQILIFISVGIFQMKHLKDFFIAKK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 42/193 (22%)
Tmed11XP_001071744.1 EMP24_GP25L 17..208 CDD:395878 42/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.