DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed7

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_079974.1 Gene:Tmed7 / 66676 MGIID:1913926 Length:224 Species:Mus musculus


Alignment Length:188 Identity:91/188 - (48%)
Similarity:121/188 - (64%) Gaps:0/188 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVA 85
            |.||:|.|||..||||:|.:.:....||||..||..|||..|:||.|||:|...|..:||..|.|
Mouse    36 EITFELPDNAKQCFYEDITQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTFTA 100

  Fly    86 ETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILDAQ 150
            ...|.|..||.|:||.|:||.||.||||||:|.|...:...:.|||||::..:||:.|..::|.|
Mouse   101 SRNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVIDYQ 165

  Fly   151 THHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRKPSQAHYG 208
            ||.||||||||.||||||.||..||..|...::|:.:.|:.:|::||:|::.:....|
Mouse   166 THFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSVGQVFLLKSFFSDKRTTTTRVG 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 87/175 (50%)
Tmed7NP_079974.1 EMP24_GP25L 36..213 CDD:307313 88/176 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841013
Domainoid 1 1.000 184 1.000 Domainoid score I3403
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45644
Inparanoid 1 1.050 192 1.000 Inparanoid score I3850
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52485
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 1 1.000 - - otm43604
orthoMCL 1 0.900 - - OOG6_103696
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 1 1.000 - - X1789
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.