DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed6

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_079734.1 Gene:Tmed6 / 66269 MGIID:1913519 Length:239 Species:Mus musculus


Alignment Length:216 Identity:58/216 - (26%)
Similarity:90/216 - (41%) Gaps:55/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EFTFDLADNAVDCFYEEIKKNSSAYFEFQVS--AGGQLD--VDVTLKDPQGKVIYSLEKATFDSH 81
            :|...::..|::||::...:....||.::|.  .|...|  :..|...|||.:|        |:.
Mouse    43 DFAIVVSPGAIECFWQFADQMGYLYFSYEVQRILGMSHDRHIVATAHTPQGFLI--------DTS 99

  Fly    82 Q-------FVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAI 139
            |       |..:.||.|..|..|:.:.||...||::|.|..|.  |.||.           .|:.
Mouse   100 QDVRGQINFATQETGFYQLCLKNEQNRFSSIQVYLNFGVFYEG--PEVDH-----------KQSQ 151

  Fly   140 HKGLNDILDA----------QTHHRLR---EAQGRKRAEDLNQR-----VMVWSSLETAAVIVIG 186
            .|.|||.|||          |..|..|   .|:.||.|:....:     |..||:.::.|:::.|
Mouse   152 RKQLNDTLDAIKDSTQRVENQVFHMWRFYNYARMRKVADFFLLQSNYTYVNWWSTAQSLAIVLSG 216

  Fly   187 LVQIMVLRNFFT-----DRKP 202
            .:|:..|:..||     .:||
Mouse   217 ALQLYFLKRLFTASTTDTKKP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 54/204 (26%)
Tmed6NP_079734.1 EMP24_GP25L 43..227 CDD:279450 54/204 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1693
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.