DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and Tmed2

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001380734.1 Gene:Tmed2 / 65165 RGDID:69243 Length:208 Species:Rattus norvegicus


Alignment Length:214 Identity:57/214 - (26%)
Similarity:96/214 - (44%) Gaps:29/214 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QIVVFAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGK 68
            :::|...||:   .:|..:...:..:|.:||:|.:...:.....|:|:.||.||:||.:..|..|
  Rat     6 ELLVLLAALL---ATASGYFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNK 67

  Fly    69 VIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGV---------DE 124
            .||..::.:...:.|.|...|.|..||.|:.|..:.|||.....:||.|....:         |.
  Rat    68 GIYKGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQDMETEGGGDSWDA 132

  Fly   125 HATVLTQMETSSQAIHKGLNDILDAQT-------HHRLREAQGRKRAEDLNQRVMVWSSLETAAV 182
            |...|.:|          :|::..|.|       :..:||...|...::.|.||::||..|...:
  Rat   133 HQNKLEEM----------INELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVVLWSFFEALVL 187

  Fly   183 IVIGLVQIMVLRNFFTDRK 201
            :.:.|.||..|:.||..|:
  Rat   188 VAMTLGQIYYLKRFFEVRR 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 50/191 (26%)
Tmed2NP_001380734.1 EMP24_GP25L 23..203 CDD:395878 51/189 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.