DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed9

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_005173235.1 Gene:tmed9 / 613145 ZFINID:ZDB-GENE-050417-434 Length:223 Species:Danio rerio


Alignment Length:215 Identity:55/215 - (25%)
Similarity:100/215 - (46%) Gaps:26/215 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FAVALMMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQ-----------VSAGGQLDVDVT 61
            |.|.|.::........|.:.:....||.|||...:.....::           :.|...|.:.|.
Zfish    12 FLVLLNIYNSLVSALYFHIGETEKKCFIEEIPDETMIIGNYRTQLYDKQKEEYLPATQGLGMFVE 76

  Fly    62 LKDPQGKVIYSLEKATFDSHQFVAETTGVYTACF---GNQFSAFSHKI--VYVDFQVGEEPALPG 121
            :|||..|||.|.:..:.....|.:.|.|.:..|.   .::|:.|:..:  |::|.||||.     
Zfish    77 VKDPDEKVILSRQYGSEGRFIFTSHTPGEHQICLHSNSSKFALFAGGMLRVHLDIQVGEH----- 136

  Fly   122 VDEHATV-----LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVWSSLETAA 181
            .:.:|.:     ||:::...:.:.:.::.|...|.:.|.||.:.|:.:|..||||:.||.::|..
Zfish   137 TNNYAEIAAKDKLTELQLRVRQLMEQVDQIQKEQNYQRYREERFRQTSESTNQRVLWWSIVQTLI 201

  Fly   182 VIVIGLVQIMVLRNFFTDRK 201
            ::.||..|:..|::||..:|
Zfish   202 LVAIGFWQMRHLKSFFEAKK 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 49/196 (25%)
tmed9XP_005173235.1 EMP24_GP25L 25..218 CDD:279450 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.