DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and tmed5

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_031755940.1 Gene:tmed5 / 549314 XenbaseID:XB-GENE-951292 Length:223 Species:Xenopus tropicalis


Alignment Length:232 Identity:62/232 - (26%)
Similarity:106/232 - (45%) Gaps:38/232 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTQIVVFAVALMM------HCIS-----AVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGG 54
            |..:.|:|   ||:      ||:.     ..::||.|.....:||::.:|::::...|:||..|.
 Frog     1 MGKEAVLF---LMLTHYTVRHCMGFSQSVDSDYTFTLPAGQKECFFQPMKRDATLEIEYQVLDGA 62

  Fly    55 QLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPAL 119
            .||||.:|..|.|:::.|.|:.:...|. |....|.|..||.|.||..|.|:::.      |..|
 Frog    63 GLDVDFSLTSPNGELLLSEERQSDGVHS-VETIDGDYQFCFDNSFSRMSEKVIFF------ELIL 120

  Fly   120 PGVDEHATVLTQME---TSSQAIHKGLNDILDA--------------QTHHRLREAQGRKRAEDL 167
            ..:::....|...:   |.:..:...|.|||:.              ||..:..||:.|...|..
 Frog   121 DHLNDEGNELEDWKSYITGTDLLDMKLEDILETINSVKGRLTKSAQIQTLLKAFEARDRNLQESN 185

  Fly   168 NQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRKPSQ 204
            .:||..||......::|:..:|:.:||:.|.|::.|:
 Frog   186 FERVTFWSVFNLTVMVVVSALQVYMLRSLFEDKRKSR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 52/192 (27%)
tmed5XP_031755940.1 EMP24_GP25L 29..216 CDD:395878 52/193 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1292519at2759
OrthoFinder 1 1.000 - - FOG0000272
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1790
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.