DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p24-1 and TMED7

DIOPT Version :9

Sequence 1:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_861974.1 Gene:TMED7 / 51014 HGNCID:24253 Length:224 Species:Homo sapiens


Alignment Length:190 Identity:92/190 - (48%)
Similarity:122/190 - (64%) Gaps:0/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AVEFTFDLADNAVDCFYEEIKKNSSAYFEFQVSAGGQLDVDVTLKDPQGKVIYSLEKATFDSHQF 83
            |.|.||:|.|||..||||:|.:.:....||||..||..|||..|:||.|||:|...|..:||..|
Human    34 ASEITFELPDNAKQCFYEDIAQGTKCTLEFQVITGGHYDVDCRLEDPDGKVLYKEMKKQYDSFTF 98

  Fly    84 VAETTGVYTACFGNQFSAFSHKIVYVDFQVGEEPALPGVDEHATVLTQMETSSQAIHKGLNDILD 148
            .|...|.|..||.|:||.|:||.||.||||||:|.|...:...:.|||||::..:||:.|..::|
Human    99 TASKNGTYKFCFSNEFSTFTHKTVYFDFQVGEDPPLFPSENRVSALTQMESACVSIHEALKSVID 163

  Fly   149 AQTHHRLREAQGRKRAEDLNQRVMVWSSLETAAVIVIGLVQIMVLRNFFTDRKPSQAHYG 208
            .|||.||||||||.||||||.||..||..|...::|:.:.|:.:|::||:|::.:....|
Human   164 YQTHFRLREAQGRSRAEDLNTRVAYWSVGEALILLVVSIGQVFLLKSFFSDKRTTTTRVG 223

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 87/175 (50%)
TMED7NP_861974.1 EMP24_GP25L 36..213 CDD:307313 88/176 (50%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..224 4/13 (31%)